Protein Family IF07714
Metagenome
Isolate
127
Members
67
Samples
115
Scaffolds
239.57
Avg Length
Representative Sequence
- ID
- 3300042616|Ga0466715_233135|Ga0466715_233135_5310_6122
- Length
- 270 aa
- Sequence
- MRATATVPRTIAVPVATVAAPDPVMRRHMLDNIFLEDILFLDIETVPQAFGLDKLDEISRRLWEDKAAVFCKDGQTPADVYGRAGIYAEFGKIICISVGFLYRTDETWALRLKSCFGENEKDLLLEFSETVAKFARQHNTLLCAHNGKEFDFPYIARRMLINGIRLPAVIDVAGKKPWEVPFLDTMELWSFGDRKNYTSLKLLAHVFDIPSPKDDIDGSQVAEIFWKEKDLLRIVRYCEKXXLTIARLLLRYKGLPTIPPEMISSSTIFG
Sample Types
Isolate
9.4%
Metagenome
90.5%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
36.1%
Kalotermitidae
23.0%
Formicidae
6.6%
Drosophilidae
4.9%
Termopsidae
4.9%
Unclassified
4.9%
Passalidae
3.3%
Elmidae
3.3%
Rhinotermitidae
3.3%
Nephropidae
1.6%
Cambaridae
1.6%
Kiwaidae
1.6%
Hodotermitidae
1.6%
Tenebrionidae
1.6%
Daphniidae
1.6%
Taxonomy
Archaea
0
Bacteria
123
Eukaryota
0
Viruses
0
Unclassified
4
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 2 | 2718218155 | Flavobacteriaceae bacterium UJ101 | Isolate | |
| 3 | 2864878056 | Flavobacterium notoginsengisoli S00128 | Isolate | Elmidae |
| 4 | 2864886855 | Flavobacterium nitrogenifigens S00142 | Isolate | Elmidae |
| 5 | 3300007143 | Drosophila gut microbial communities from New York, USA - Drosophila putrida female 3 gut | Metagenome | Drosophilidae |
| 6 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 7 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 8 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 9 | 3300007095 | Ant gut microbial communities from Cephalotes minutus, Brazil | Metagenome | Formicidae |
| 10 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 11 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 12 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 13 | 2838772460 | Aquimarina sp. I32.4 | Isolate | Nephropidae |
| 14 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 15 | 3300007150 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 3 gut | Metagenome | Drosophilidae |
| 16 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 17 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 18 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 19 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 20 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 21 | 2509276035 | Saprospira grandis HR1, DSM 2844 | Isolate | |
| 22 | 2958471994 | Flavobacterium sp. xlx-221 | Isolate | Cambaridae |
| 23 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 24 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 25 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 26 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 27 | 3300013007 | Symbiotic microbial communities associated with the hydrothermal yeti crab kiwa sp. n. from the East Pacific Rise in the East Pacific Ocean - crab 1, guts | Metagenome | Kiwaidae |
| 28 | 2882250448 | Bizionia sp. APA-3 | Isolate | |
| 29 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 30 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 31 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 32 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 33 | 3300007052 | Ant gut microbial communities from Cephalotes eduarduli, Brazil | Metagenome | Formicidae |
| 34 | 3300007153 | Drosophila gut microbial communities from New York, USA - Drosophila putrida male 3 gut | Metagenome | Drosophilidae |
| 35 | 3300007190 | Ant gut microbial communities from Cephalotes umbraculatus, Peru | Metagenome | Formicidae |
| 36 | 3300007192 | Ant gut microbial communities from Cephalotes persimplex, Brazil | Metagenome | Formicidae |
| 37 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 38 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 39 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 40 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 41 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 42 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 43 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 44 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 45 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 46 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 47 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 48 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 49 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 50 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 51 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 52 | 2899132286 | Myroides albus BIT-d1 | Isolate | Tenebrionidae |
| 53 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 54 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 55 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 56 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 57 | 2811995047 | Flavobacterium succinicans DD5b | Isolate | Daphniidae |
| 58 | 2820750388 | Unclassified Bacteroidetes Nt197P3bin50 | Isolate | Unclassified |
| 59 | 2820757377 | Unclassified Bacteroidetes Mp193P4bin6 | Isolate | Unclassified |
| 60 | 2904728850 | Flavobacterium sp. xlx-214 | Isolate | |
| 61 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 62 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 63 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 64 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 65 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 66 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 67 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466698_185181 | 3300042610 | Bacteria | 2031 |
| 2 | Ga0123354_10004397 | 3300010882 | Bacteria | 19955 |
| 3 | Ga0123354_10271018 | 3300010882 | Bacteria | 1671 |
| 4 | Ga0466715_031266 | 3300042616 | Bacteria | 10063 |
| 5 | Ga0466715_645221 | 3300042616 | Bacteria | 7850 |
| 6 | Ga0466723_040839 | 3300042618 | Bacteria | 20873 |
| 7 | Ga0466726_288688 | 3300042619 | Bacteria | 30753 |
| 8 | Ga0466728_059911 | 3300042620 | Bacteria | 1674 |
| 9 | Ga0466690_240026 | 3300042590 | Bacteria | 6801 |
| 10 | Ga0466691_224837 | 3300042593 | Bacteria | 24037 |
| 11 | Ga0466724_23916 | 3300042649 | Bacteria | 557842 |
| 12 | 2227086375 | 2225789004 | Bacteria | 9943 |
| 13 | JGI24702J35022_10308838 | 3300002462 | Bacteria | 935 |
| 14 | Ga0072941_1083339 | 3300005201 | Bacteria | 15001 |
| 15 | Ga0104019_1003343 | 3300007150 | Unclassified | 2306 |
| 16 | Ga0104019_1031108 | 3300007150 | Unclassified | 2906 |
| 17 | Ga0104019_1192998 | 3300007150 | Bacteria | 1519 |
| 18 | Ga0104050_1016439 | 3300007153 | Bacteria | 1826 |
| 19 | Ga0103267_1000157 | 3300007190 | Bacteria | 37935 |
| 20 | Ga0466733_144976 | 3300042659 | Bacteria | 11379 |
| 21 | Ga0466700_101795 | 3300042600 | Bacteria | 1023 |
| 22 | Ga0466722_116433 | 3300042609 | Bacteria | 4777 |
| 23 | Ga0466705_457675 | 3300042612 | Bacteria | 39622 |
| 24 | Ga0466690_419906 | 3300042590 | Bacteria | 3999 |
| 25 | Ga0466703_269606 | 3300042636 | Bacteria | 7729 |
| 26 | Ga0466709_185660 | 3300042648 | Bacteria | 43932 |
| 27 | 2227479363 | 2225789004 | Bacteria | 4498 |
| 28 | Ga0466697_275042 | 3300042611 | Bacteria | 1571 |
| 29 | Ga0466714_058436 | 3300042603 | Bacteria | 50482 |
| 30 | Ga0123356_10554763 | 3300010049 | Bacteria | 1310 |
| 31 | Ga0123353_10072506 | 3300010167 | Bacteria | 5534 |
| 32 | Ga0123353_10113344 | 3300010167 | Bacteria | 4365 |
| 33 | Ga0466723_135882 | 3300042618 | Bacteria | 78165 |
| 34 | IMNBL1DRAFT_c0014540 | 3300000062 | Bacteria | 3466 |
| 35 | Ga0104050_1027598 | 3300007153 | Unclassified | 1821 |
| 36 | Ga0103268_1000173 | 3300007192 | Bacteria | 21119 |
| 37 | Ga0466733_092628 | 3300042659 | Bacteria | 5283 |
| 38 | Ga0466733_190275 | 3300042659 | Bacteria | 18255 |
| 39 | Ga0466701_071394 | 3300042598 | Bacteria | 38887 |
| 40 | Ga0466707_352912 | 3300042601 | Bacteria | 8824 |
| 41 | Ga0466714_033894 | 3300042603 | Bacteria | 61713 |
| 42 | Ga0466719_048872 | 3300042606 | Bacteria | 1683 |
| 43 | Ga0466715_008550 | 3300042616 | Bacteria | 39825 |
| 44 | Ga0466726_032617 | 3300042619 | Bacteria | 4891 |
| 45 | Ga0466726_238211 | 3300042619 | Bacteria | 2139 |
| 46 | Ga0466729_178582 | 3300042621 | Bacteria | 15596 |
| 47 | Ga0466690_187604 | 3300042590 | Bacteria | 1536 |
| 48 | Ga0466691_204801 | 3300042593 | Bacteria | 98819 |
| 49 | Ga0466696_197304 | 3300042596 | Bacteria | 4028 |
| 50 | Ga0466734_017117 | 3300042623 | Bacteria | 1898 |
| 51 | Ga0466725_419383 | 3300042654 | Bacteria | 2398 |
| 52 | IMNBL1DRAFT_c0000476 | 3300000062 | Bacteria | 33531 |
| 53 | JGI24699J35502_11133861 | 3300002509 | Bacteria | 17399 |
| 54 | JGI24696J40584_12960899 | 3300002834 | Bacteria | 9170 |
| 55 | Ga0072940_1099627 | 3300005200 | Bacteria | 908 |
| 56 | Ga0104048_1000684 | 3300007143 | Bacteria | 23236 |
| 57 | Ga0104048_1002755 | 3300007143 | Bacteria | 5183 |
| 58 | Ga0466733_044214 | 3300042659 | Bacteria | 11555 |
| 59 | Ga0466707_067509 | 3300042601 | Bacteria | 6900 |
| 60 | Ga0466714_138540 | 3300042603 | Bacteria | 27343 |
| 61 | Ga0466716_262441 | 3300042605 | Bacteria | 5674 |
| 62 | Ga0466719_536637 | 3300042606 | Bacteria | 1229 |
| 63 | Ga0123356_10760607 | 3300010049 | Bacteria | 1139 |
| 64 | Ga0123356_10845171 | 3300010049 | Bacteria | 1087 |
| 65 | Ga0123353_10426389 | 3300010167 | Bacteria | 1963 |
| 66 | Ga0466728_104542 | 3300042620 | Bacteria | 2221 |
| 67 | Ga0466657_354304 | 3300042582 | Bacteria | 1000 |
| 68 | Ga0466695_340885 | 3300042595 | Bacteria | 2868 |
| 69 | Ga0466735_132899 | 3300042624 | Bacteria | 5027 |
| 70 | Ga0466730_084503 | 3300042625 | Bacteria | 1429 |
| 71 | Ga0466709_184405 | 3300042648 | Bacteria | 30874 |
| 72 | Ga0466708_398853 | 3300042652 | Bacteria | 19626 |
| 73 | JGI24702J35022_10028528 | 3300002462 | Bacteria | 2998 |
| 74 | Ga0466733_166572 | 3300042659 | Bacteria | 14258 |
| 75 | Ga0466701_050423 | 3300042598 | Bacteria | 264361 |
| 76 | Ga0466701_064388 | 3300042598 | Bacteria | 1320 |
| 77 | Ga0466706_038976 | 3300042599 | Bacteria | 24610 |
| 78 | Ga0466706_102931 | 3300042599 | Bacteria | 7666 |
| 79 | Ga0466707_117545 | 3300042601 | Bacteria | 11233 |
| 80 | Ga0466714_013068 | 3300042603 | Bacteria | 2618 |
| 81 | Ga0466719_429284 | 3300042606 | Bacteria | 1297 |
| 82 | Ga0466722_267989 | 3300042609 | Bacteria | 2689 |
| 83 | Ga0466711_363285 | 3300042615 | Bacteria | 32228 |
| 84 | Ga0466715_233135 | 3300042616 | Bacteria | 16848 |
| 85 | Ga0157631_124153 | 3300013007 | Bacteria | 5030 |
| 86 | Ga0466656_276859 | 3300042550 | Bacteria | 1485 |
| 87 | Ga0466696_004307 | 3300042596 | Bacteria | 3753 |
| 88 | Ga0466735_200100 | 3300042624 | Bacteria | 1674 |
| 89 | Ga0466727_063819 | 3300042655 | Bacteria | 4244 |
| 90 | IMNBL1DRAFT_c0027403 | 3300000062 | Bacteria | 2143 |
| 91 | Ga0072940_1099628 | 3300005200 | Bacteria | 3486 |
| 92 | Ga0466722_116297 | 3300042609 | Bacteria | 4889 |
| 93 | Ga0123355_10262814 | 3300009826 | Bacteria | 2411 |
| 94 | Ga0466715_224461 | 3300042616 | Bacteria | 9732 |
| 95 | Ga0264413_151565 | 3300024493 | Bacteria | 2972 |
| 96 | Ga0466657_229008 | 3300042582 | Bacteria | 97233 |
| 97 | Ga0466703_069735 | 3300042636 | Bacteria | 16372 |
| 98 | Ga0466727_187680 | 3300042655 | Bacteria | 7551 |
| 99 | JGI24702J35022_10091411 | 3300002462 | Bacteria | 1657 |
| 100 | JGI24702J35022_10128692 | 3300002462 | Bacteria | 1404 |
| 101 | JGI24702J35022_10197635 | 3300002462 | Bacteria | 1149 |
| 102 | Ga0102736_1000068 | 3300007052 | Bacteria | 53396 |
| 103 | Ga0466701_055630 | 3300042598 | Unclassified | 1225 |
| 104 | Ga0466722_051152 | 3300042609 | Bacteria | 5390 |
| 105 | Ga0123357_10099942 | 3300009784 | Bacteria | 3743 |
| 106 | Ga0123354_10174547 | 3300010882 | Bacteria | 2484 |
| 107 | Ga0466711_035584 | 3300042615 | Bacteria | 18685 |
| 108 | Ga0466715_098507 | 3300042616 | Bacteria | 24113 |
| 109 | Ga0466728_167684 | 3300042620 | Bacteria | 1332 |
| 110 | Ga0466696_087909 | 3300042596 | Bacteria | 9563 |
| 111 | Ga0466704_090178 | 3300042643 | Bacteria | 23929 |
| 112 | Ga0466709_070059 | 3300042648 | Bacteria | 19387 |
| 113 | Ga0102739_1000011 | 3300007095 | Bacteria | 63975 |
| 114 | Ga0103267_1000071 | 3300007190 | Bacteria | 38177 |
| 115 | Ga0103267_1000166 | 3300007190 | Bacteria | 25917 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.