Protein Family IF07683
Metagenome
Isolate
322
Members
63
Samples
318
Scaffolds
96.73
Avg Length
Representative Sequence
- ID
- 3300042616|Ga0466715_167634|Ga0466715_167634_60_395
- Length
- 111 aa
- Sequence
- VVTSTDIRRFFGDNNMMVLVSYDVMVTSPGGQKRLRKVAKACTNYGQRVQYSVFECTVDPAQWVKLKNILEKTIDEGKDSLRYYYLGANYKRRIEHVGAKPSYDVDGPIII
Sample Types
Isolate
1.2%
Metagenome
98.8%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
49.2%
Kalotermitidae
24.6%
Unclassified
8.2%
Rhinotermitidae
6.6%
Termopsidae
6.6%
Passalidae
3.3%
Hodotermitidae
1.6%
Taxonomy
Archaea
12
Bacteria
259
Eukaryota
0
Viruses
0
Unclassified
51
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2740892545 | Fibrobacteria bacterium GUT31 IN01_31 | Isolate | Unclassified |
| 2 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 3 | 3300002508 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 | Metagenome | Termitidae |
| 4 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 5 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 6 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 7 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 8 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 9 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 10 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 11 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 12 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 13 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 14 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 15 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 16 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 17 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 18 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 19 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 20 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 21 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 22 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 23 | 651324002 | Acetonema longum APO-1, DSM 6540 | Isolate | Kalotermitidae |
| 24 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 25 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 26 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 27 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 28 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 29 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 30 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 31 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 32 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 33 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 34 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 35 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 36 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 37 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 38 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 39 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 40 | 3300002507 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 | Metagenome | Termitidae |
| 41 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 42 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 43 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 44 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 45 | 2819994798 | Unclassified Spirochaetes Th196P1bin3 | Isolate | Unclassified |
| 46 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 47 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 48 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 49 | 2820753519 | Unclassified Bacteroidetes Nc150P4bin20 | Isolate | Unclassified |
| 50 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 51 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 52 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 53 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 54 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 55 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 56 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 57 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 58 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 59 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 60 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 61 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 62 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 63 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466727_351734 | 3300042655 | Bacteria | 1403 |
| 2 | Ga0466732_216825 | 3300042656 | Bacteria | 1097 |
| 3 | Ga0466732_230295 | 3300042656 | Archaea | 3802 |
| 4 | Ga0466732_434866 | 3300042656 | Bacteria | 1023 |
| 5 | Ga0466733_060129 | 3300042659 | Bacteria | 1846 |
| 6 | JGI24698J34947_10001161 | 3300002449 | Bacteria | 13704 |
| 7 | JGI24698J34947_10002209 | 3300002449 | Archaea | 10431 |
| 8 | JGI24698J34947_10002244 | 3300002449 | Bacteria | 10351 |
| 9 | JGI24698J34947_10046378 | 3300002449 | Bacteria | 2211 |
| 10 | JGI24695J34938_10015184 | 3300002450 | Bacteria | 3959 |
| 11 | JGI24705J35276_11960102 | 3300002504 | Bacteria | 804 |
| 12 | Ga0068302_10136933 | 3300005071 | Bacteria | 1097 |
| 13 | Ga0072941_1020632 | 3300005201 | Bacteria | 4894 |
| 14 | Ga0466712_020278 | 3300042614 | Unclassified | 1191 |
| 15 | Ga0466715_216258 | 3300042616 | Bacteria | 1983 |
| 16 | Ga0466718_056676 | 3300042617 | Bacteria | 2278 |
| 17 | Ga0466718_057262 | 3300042617 | Bacteria | 1236 |
| 18 | Ga0466718_161177 | 3300042617 | Bacteria | 6010 |
| 19 | Ga0466729_236667 | 3300042621 | Bacteria | 1585 |
| 20 | Ga0466731_340200 | 3300042622 | Bacteria | 1056 |
| 21 | Ga0466735_122952 | 3300042624 | Bacteria | 8707 |
| 22 | Ga0466702_034974 | 3300042635 | Bacteria | 1833 |
| 23 | Ga0466702_126154 | 3300042635 | Bacteria | 1209 |
| 24 | Ga0466704_051209 | 3300042643 | Bacteria | 6445 |
| 25 | Ga0466704_333338 | 3300042643 | Unclassified | 8765 |
| 26 | Ga0466708_075527 | 3300042652 | Bacteria | 19206 |
| 27 | Ga0466708_232580 | 3300042652 | Bacteria | 2474 |
| 28 | Ga0466708_334215 | 3300042652 | Bacteria | 2078 |
| 29 | Ga0264413_109283 | 3300024493 | Bacteria | 11739 |
| 30 | Ga0466690_169802 | 3300042590 | Bacteria | 1141 |
| 31 | Ga0466707_069717 | 3300042601 | Bacteria | 4212 |
| 32 | Ga0466707_204868 | 3300042601 | Bacteria | 2606 |
| 33 | Ga0466716_098689 | 3300042605 | Bacteria | 3685 |
| 34 | Ga0466716_390436 | 3300042605 | Bacteria | 2718 |
| 35 | Ga0466719_158310 | 3300042606 | Bacteria | 12211 |
| 36 | Ga0466719_355598 | 3300042606 | Bacteria | 1982 |
| 37 | Ga0466720_110725 | 3300042607 | Archaea | 24728 |
| 38 | Ga0466721_049037 | 3300042608 | Bacteria | 26773 |
| 39 | Ga0123357_10060183 | 3300009784 | Bacteria | 5094 |
| 40 | Ga0123357_10519286 | 3300009784 | Bacteria | 974 |
| 41 | Ga0123356_10037760 | 3300010049 | Bacteria | 4504 |
| 42 | Ga0123356_10156763 | 3300010049 | Bacteria | 2268 |
| 43 | Ga0123356_11903825 | 3300010049 | Bacteria | 740 |
| 44 | Ga0123356_12163171 | 3300010049 | Unclassified | 695 |
| 45 | Ga0123356_13165535 | 3300010049 | Bacteria | 573 |
| 46 | Ga0123353_10033650 | 3300010167 | Bacteria | 7985 |
| 47 | Ga0123353_10292315 | 3300010167 | Bacteria | 2493 |
| 48 | Ga0123353_10357890 | 3300010167 | Bacteria | 2195 |
| 49 | Ga0123353_10484991 | 3300010167 | Unclassified | 1807 |
| 50 | Ga0123353_12414770 | 3300010167 | Bacteria | 628 |
| 51 | Ga0123354_11045778 | 3300010882 | Bacteria | 522 |
| 52 | Ga0466705_288700 | 3300042612 | Bacteria | 3024 |
| 53 | Ga0466732_107947 | 3300042656 | Archaea | 6011 |
| 54 | Ga0466732_318377 | 3300042656 | Bacteria | 1847 |
| 55 | AustNasuHG_c1019353 | 3300000089 | Bacteria | 2235 |
| 56 | JGI24698J34947_10000641 | 3300002449 | Archaea | 16899 |
| 57 | JGI24698J34947_10001166 | 3300002449 | Bacteria | 13688 |
| 58 | JGI24695J34938_10020202 | 3300002450 | Bacteria | 3283 |
| 59 | JGI24697J35500_11151928 | 3300002507 | Unclassified | 1357 |
| 60 | Ga0072941_1148260 | 3300005201 | Bacteria | 8859 |
| 61 | Ga0466712_018447 | 3300042614 | Bacteria | 4181 |
| 62 | Ga0466711_035070 | 3300042615 | Unclassified | 2591 |
| 63 | Ga0466715_457675 | 3300042616 | Bacteria | 2150 |
| 64 | Ga0466715_485262 | 3300042616 | Bacteria | 2097 |
| 65 | Ga0466715_634349 | 3300042616 | Unclassified | 1479 |
| 66 | Ga0466723_359811 | 3300042618 | Bacteria | 3622 |
| 67 | Ga0466729_279450 | 3300042621 | Bacteria | 1065 |
| 68 | Ga0466704_297062 | 3300042643 | Bacteria | 1507 |
| 69 | Ga0466709_287272 | 3300042648 | Bacteria | 2355 |
| 70 | Ga0466709_331807 | 3300042648 | Bacteria | 1726 |
| 71 | Ga0466708_227649 | 3300042652 | Bacteria | 5244 |
| 72 | Ga0466727_106916 | 3300042655 | Bacteria | 2977 |
| 73 | Ga0466727_116732 | 3300042655 | Bacteria | 4343 |
| 74 | Ga0264413_137104 | 3300024493 | Bacteria | 2617 |
| 75 | Ga0264413_137105 | 3300024493 | Unclassified | 1609 |
| 76 | Ga0466690_057287 | 3300042590 | Bacteria | 2652 |
| 77 | Ga0466690_153753 | 3300042590 | Bacteria | 3272 |
| 78 | Ga0466691_037546 | 3300042593 | Bacteria | 1784 |
| 79 | Ga0466691_063113 | 3300042593 | Bacteria | 8979 |
| 80 | Ga0466699_392031 | 3300042597 | Bacteria | 2553 |
| 81 | Ga0466706_195034 | 3300042599 | Bacteria | 1086 |
| 82 | Ga0466717_308577 | 3300042604 | Bacteria | 2103 |
| 83 | Ga0466716_296572 | 3300042605 | Bacteria | 11179 |
| 84 | Ga0466722_042796 | 3300042609 | Bacteria | 1656 |
| 85 | Ga0123356_10001816 | 3300010049 | Bacteria | 23215 |
| 86 | Ga0123356_10044372 | 3300010049 | Bacteria | 4138 |
| 87 | Ga0123356_10271669 | 3300010049 | Unclassified | 1785 |
| 88 | Ga0123356_11258013 | 3300010049 | Bacteria | 904 |
| 89 | Ga0123356_12741400 | 3300010049 | Unclassified | 617 |
| 90 | Ga0123353_11170990 | 3300010167 | Bacteria | 1012 |
| 91 | Ga0123353_11492899 | 3300010167 | Unclassified | 861 |
| 92 | Ga0123353_12098231 | 3300010167 | Bacteria | 688 |
| 93 | Ga0123354_10316401 | 3300010882 | Unclassified | 1448 |
| 94 | Ga0466733_206181 | 3300042659 | Bacteria | 41168 |
| 95 | JGI24698J34947_10001642 | 3300002449 | Bacteria | 11904 |
| 96 | JGI24698J34947_10260003 | 3300002449 | Unclassified | 644 |
| 97 | JGI24702J35022_10002582 | 3300002462 | Bacteria | 11007 |
| 98 | JGI24705J35276_12149456 | 3300002504 | Bacteria | 1176 |
| 99 | Ga0072941_1000156 | 3300005201 | Bacteria | 33336 |
| 100 | Ga0466710_036870 | 3300042613 | Bacteria | 2421 |
| 101 | Ga0466723_117219 | 3300042618 | Bacteria | 1949 |
| 102 | Ga0466726_380277 | 3300042619 | Bacteria | 2172 |
| 103 | Ga0466728_050012 | 3300042620 | Bacteria | 27881 |
| 104 | Ga0466728_132128 | 3300042620 | Bacteria | 58067 |
| 105 | Ga0466729_234893 | 3300042621 | Unclassified | 1250 |
| 106 | Ga0466704_326218 | 3300042643 | Bacteria | 3446 |
| 107 | Ga0466708_105600 | 3300042652 | Bacteria | 11940 |
| 108 | Ga0264413_113986 | 3300024493 | Unclassified | 1974 |
| 109 | Ga0466693_339292 | 3300042592 | Bacteria | 3117 |
| 110 | Ga0466707_308091 | 3300042601 | Bacteria | 3221 |
| 111 | Ga0466707_363340 | 3300042601 | Bacteria | 4437 |
| 112 | Ga0466720_024882 | 3300042607 | Bacteria | 1726 |
| 113 | Ga0466720_125977 | 3300042607 | Archaea | 1617 |
| 114 | Ga0466722_142352 | 3300042609 | Bacteria | 9169 |
| 115 | Ga0466698_038192 | 3300042610 | Bacteria | 1366 |
| 116 | Ga0123355_10061625 | 3300009826 | Bacteria | 6055 |
| 117 | Ga0123356_13915301 | 3300010049 | Bacteria | 513 |
| 118 | Ga0123353_10114653 | 3300010167 | Bacteria | 4338 |
| 119 | Ga0123353_10514309 | 3300010167 | Bacteria | 1739 |
| 120 | Ga0123353_11078783 | 3300010167 | Unclassified | 1069 |
| 121 | Ga0123353_11726583 | 3300010167 | Bacteria | 782 |
| 122 | Ga0123353_11960541 | 3300010167 | Bacteria | 719 |
| 123 | Ga0123353_12136209 | 3300010167 | Unclassified | 680 |
| 124 | Ga0123353_13188949 | 3300010167 | Bacteria | 526 |
| 125 | Ga0123353_13428065 | 3300010167 | Bacteria | 502 |
| 126 | Ga0123354_10022613 | 3300010882 | Unclassified | 9913 |
| 127 | JGI24698J34947_10170090 | 3300002449 | Bacteria | 883 |
| 128 | JGI24702J35022_10266198 | 3300002462 | Bacteria | 1002 |
| 129 | JGI24702J35022_10503102 | 3300002462 | Unclassified | 743 |
| 130 | Ga0072941_1011664 | 3300005201 | Bacteria | 17442 |
| 131 | Ga0466712_017245 | 3300042614 | Bacteria | 2828 |
| 132 | Ga0466712_247158 | 3300042614 | Bacteria | 1206 |
| 133 | Ga0466715_035997 | 3300042616 | Bacteria | 13062 |
| 134 | Ga0466718_040505 | 3300042617 | Archaea | 3408 |
| 135 | Ga0466726_050755 | 3300042619 | Unclassified | 1341 |
| 136 | Ga0466726_286681 | 3300042619 | Bacteria | 1496 |
| 137 | Ga0466729_121496 | 3300042621 | Unclassified | 1614 |
| 138 | Ga0466731_180010 | 3300042622 | Bacteria | 1212 |
| 139 | Ga0466735_022558 | 3300042624 | Bacteria | 2275 |
| 140 | Ga0466735_055449 | 3300042624 | Bacteria | 1009 |
| 141 | Ga0466709_100720 | 3300042648 | Bacteria | 19504 |
| 142 | Ga0466709_136254 | 3300042648 | Bacteria | 3904 |
| 143 | Ga0466709_291138 | 3300042648 | Unclassified | 1334 |
| 144 | Ga0466709_353231 | 3300042648 | Bacteria | 6996 |
| 145 | Ga0466727_210916 | 3300042655 | Bacteria | 3655 |
| 146 | Ga0264413_126159 | 3300024493 | Unclassified | 1097 |
| 147 | Ga0415639_016015 | 3300038395 | Bacteria | 3737 |
| 148 | Ga0466692_140625 | 3300042591 | Bacteria | 1609 |
| 149 | Ga0466691_019579 | 3300042593 | Bacteria | 8417 |
| 150 | Ga0466699_435039 | 3300042597 | Bacteria | 2469 |
| 151 | Ga0466706_032451 | 3300042599 | Bacteria | 1441 |
| 152 | Ga0466700_156746 | 3300042600 | Bacteria | 1069 |
| 153 | Ga0466707_286897 | 3300042601 | Bacteria | 2086 |
| 154 | Ga0123357_10336760 | 3300009784 | Bacteria | 1465 |
| 155 | Ga0123356_10938526 | 3300010049 | Unclassified | 1036 |
| 156 | Ga0123353_11011768 | 3300010167 | Unclassified | 1115 |
| 157 | Ga0123353_12242347 | 3300010167 | Unclassified | 659 |
| 158 | Ga0123353_12769491 | 3300010167 | Bacteria | 575 |
| 159 | Ga0123353_12969436 | 3300010167 | Bacteria | 550 |
| 160 | Ga0123353_13363189 | 3300010167 | Bacteria | 509 |
| 161 | Ga0466705_220499 | 3300042612 | Unclassified | 12250 |
| 162 | Ga0466732_171142 | 3300042656 | Unclassified | 1433 |
| 163 | 2227350230 | 2225789004 | Bacteria | 6175 |
| 164 | IMNBL1DRAFT_c0083623 | 3300000062 | Bacteria | 890 |
| 165 | AustNasuHG_c1000786 | 3300000089 | Bacteria | 11329 |
| 166 | AustNasuHG_c1002504 | 3300000089 | Bacteria | 6654 |
| 167 | JGI24698J34947_10003467 | 3300002449 | Bacteria | 8557 |
| 168 | JGI24698J34947_10004337 | 3300002449 | Archaea | 7724 |
| 169 | JGI24695J34938_10003063 | 3300002450 | Bacteria | 11973 |
| 170 | JGI24695J34938_10363209 | 3300002450 | Archaea | 638 |
| 171 | JGI24696J40584_12744828 | 3300002834 | Bacteria | 787 |
| 172 | Ga0068302_10323560 | 3300005071 | Bacteria | 2416 |
| 173 | Ga0466712_114640 | 3300042614 | Bacteria | 1542 |
| 174 | Ga0466711_081712 | 3300042615 | Bacteria | 8339 |
| 175 | Ga0466718_020874 | 3300042617 | Bacteria | 12328 |
| 176 | Ga0466723_214433 | 3300042618 | Bacteria | 3625 |
| 177 | Ga0466723_355848 | 3300042618 | Bacteria | 4357 |
| 178 | Ga0466726_071374 | 3300042619 | Bacteria | 7049 |
| 179 | Ga0466728_052854 | 3300042620 | Bacteria | 13917 |
| 180 | Ga0466731_381677 | 3300042622 | Bacteria | 1302 |
| 181 | Ga0466735_057548 | 3300042624 | Bacteria | 2456 |
| 182 | Ga0466735_198872 | 3300042624 | Unclassified | 1476 |
| 183 | Ga0466708_110242 | 3300042652 | Bacteria | 1835 |
| 184 | Ga0466727_215372 | 3300042655 | Bacteria | 1254 |
| 185 | Ga0466727_339437 | 3300042655 | Bacteria | 1587 |
| 186 | Ga0466692_006478 | 3300042591 | Bacteria | 1232 |
| 187 | Ga0466692_117166 | 3300042591 | Unclassified | 1065 |
| 188 | Ga0466693_196813 | 3300042592 | Unclassified | 1779 |
| 189 | Ga0466691_167177 | 3300042593 | Bacteria | 4632 |
| 190 | Ga0466696_160839 | 3300042596 | Bacteria | 5737 |
| 191 | Ga0466716_183567 | 3300042605 | Archaea | 2404 |
| 192 | Ga0466719_196682 | 3300042606 | Bacteria | 2510 |
| 193 | Ga0466720_040058 | 3300042607 | Unclassified | 1514 |
| 194 | Ga0466705_201504 | 3300042612 | Bacteria | 2748 |
| 195 | Ga0466705_279481 | 3300042612 | Bacteria | 2596 |
| 196 | IMNBL1DRAFT_c0042558 | 3300000062 | Bacteria | 1513 |
| 197 | AustNasuHG_c1040227 | 3300000089 | Unclassified | 1146 |
| 198 | JGI24698J34947_10005419 | 3300002449 | Bacteria | 6999 |
| 199 | JGI24698J34947_10007715 | 3300002449 | Unclassified | 5911 |
| 200 | JGI24698J34947_10278997 | 3300002449 | Unclassified | 611 |
| 201 | JGI24700J35501_10930494 | 3300002508 | Bacteria | 14697 |
| 202 | Ga0072940_1015031 | 3300005200 | Bacteria | 725 |
| 203 | Ga0466712_230381 | 3300042614 | Bacteria | 2072 |
| 204 | Ga0466715_454190 | 3300042616 | Bacteria | 1708 |
| 205 | Ga0466718_020270 | 3300042617 | Unclassified | 1604 |
| 206 | Ga0466726_043158 | 3300042619 | Bacteria | 1256 |
| 207 | Ga0466726_218934 | 3300042619 | Bacteria | 4751 |
| 208 | Ga0466726_478464 | 3300042619 | Bacteria | 1330 |
| 209 | Ga0466731_271123 | 3300042622 | Bacteria | 1137 |
| 210 | Ga0466708_286170 | 3300042652 | Bacteria | 1065 |
| 211 | Ga0466727_245577 | 3300042655 | Bacteria | 1714 |
| 212 | Ga0466727_264946 | 3300042655 | Bacteria | 1432 |
| 213 | Ga0466690_429103 | 3300042590 | Bacteria | 1801 |
| 214 | Ga0466691_039388 | 3300042593 | Bacteria | 2868 |
| 215 | Ga0466691_069844 | 3300042593 | Bacteria | 6378 |
| 216 | Ga0466691_191106 | 3300042593 | Bacteria | 2132 |
| 217 | Ga0466694_041002 | 3300042594 | Bacteria | 3733 |
| 218 | Ga0466700_211350 | 3300042600 | Bacteria | 1047 |
| 219 | Ga0466713_067678 | 3300042602 | Bacteria | 1516 |
| 220 | Ga0466716_024356 | 3300042605 | Bacteria | 2782 |
| 221 | Ga0466720_184867 | 3300042607 | Bacteria | 8869 |
| 222 | Ga0466720_216618 | 3300042607 | Unclassified | 5633 |
| 223 | Ga0123357_10161920 | 3300009784 | Bacteria | 2679 |
| 224 | Ga0123355_10461268 | 3300009826 | Bacteria | 1594 |
| 225 | Ga0123356_11967011 | 3300010049 | Bacteria | 729 |
| 226 | Ga0123353_10204646 | 3300010167 | Bacteria | 3102 |
| 227 | Ga0123353_10311357 | 3300010167 | Bacteria | 2396 |
| 228 | Ga0123353_10571234 | 3300010167 | Bacteria | 1625 |
| 229 | Ga0123353_11003448 | 3300010167 | Bacteria | 1121 |
| 230 | Ga0123353_11622985 | 3300010167 | Bacteria | 815 |
| 231 | Ga0123353_11917137 | 3300010167 | Unclassified | 730 |
| 232 | 2227671817 | 2225789004 | Unclassified | 10194 |
| 233 | AustNasuHG_c1014077 | 3300000089 | Bacteria | 2729 |
| 234 | AustNasuHG_c1014590 | 3300000089 | Bacteria | 2667 |
| 235 | JGI24702J35022_10002994 | 3300002462 | Bacteria | 10225 |
| 236 | Ga0068302_10125132 | 3300005071 | Bacteria | 1654 |
| 237 | Ga0123357_10000242 | 3300009784 | Bacteria | 52078 |
| 238 | Ga0466712_093766 | 3300042614 | Bacteria | 1350 |
| 239 | Ga0466712_274329 | 3300042614 | Unclassified | 1325 |
| 240 | Ga0466711_014504 | 3300042615 | Bacteria | 9096 |
| 241 | Ga0466715_338843 | 3300042616 | Bacteria | 2528 |
| 242 | Ga0466718_113661 | 3300042617 | Bacteria | 3643 |
| 243 | Ga0466723_059636 | 3300042618 | Bacteria | 2732 |
| 244 | Ga0466726_414599 | 3300042619 | Bacteria | 1163 |
| 245 | Ga0466726_422185 | 3300042619 | Bacteria | 1531 |
| 246 | Ga0466728_088162 | 3300042620 | Bacteria | 4144 |
| 247 | Ga0466729_128444 | 3300042621 | Bacteria | 1388 |
| 248 | Ga0466729_195099 | 3300042621 | Bacteria | 1206 |
| 249 | Ga0466735_004317 | 3300042624 | Bacteria | 8207 |
| 250 | Ga0466702_382583 | 3300042635 | Bacteria | 2504 |
| 251 | Ga0466704_301300 | 3300042643 | Bacteria | 1179 |
| 252 | Ga0466708_117958 | 3300042652 | Bacteria | 4366 |
| 253 | Ga0466708_200443 | 3300042652 | Unclassified | 2403 |
| 254 | Ga0466692_114910 | 3300042591 | Bacteria | 2296 |
| 255 | Ga0466691_026306 | 3300042593 | Bacteria | 1419 |
| 256 | Ga0466691_102898 | 3300042593 | Unclassified | 3242 |
| 257 | Ga0466694_272936 | 3300042594 | Bacteria | 1408 |
| 258 | Ga0466696_018322 | 3300042596 | Bacteria | 8215 |
| 259 | Ga0466696_281147 | 3300042596 | Bacteria | 2712 |
| 260 | Ga0466713_102255 | 3300042602 | Bacteria | 3236 |
| 261 | Ga0466717_124201 | 3300042604 | Bacteria | 1225 |
| 262 | Ga0466719_075940 | 3300042606 | Bacteria | 2857 |
| 263 | Ga0466719_403250 | 3300042606 | Bacteria | 2403 |
| 264 | Ga0466720_205253 | 3300042607 | Bacteria | 9923 |
| 265 | Ga0466722_201542 | 3300042609 | Bacteria | 2214 |
| 266 | Ga0466698_151415 | 3300042610 | Bacteria | 1716 |
| 267 | Ga0123356_10081920 | 3300010049 | Bacteria | 3054 |
| 268 | Ga0123356_10117274 | 3300010049 | Bacteria | 2583 |
| 269 | Ga0123356_13603941 | 3300010049 | Bacteria | 536 |
| 270 | Ga0123353_11245633 | 3300010167 | Bacteria | 971 |
| 271 | Ga0123353_11585322 | 3300010167 | Bacteria | 828 |
| 272 | Ga0123354_10132543 | 3300010882 | Unclassified | 3138 |
| 273 | AustNasuHG_c1008003 | 3300000089 | Archaea | 3744 |
| 274 | JGI24698J34947_10115440 | 3300002449 | Unclassified | 1176 |
| 275 | JGI24698J34947_10212844 | 3300002449 | Unclassified | 747 |
| 276 | Ga0068302_10243915 | 3300005071 | Bacteria | 619 |
| 277 | Ga0466715_167634 | 3300042616 | Bacteria | 1000 |
| 278 | Ga0466718_008821 | 3300042617 | Unclassified | 4060 |
| 279 | Ga0466718_150385 | 3300042617 | Unclassified | 1418 |
| 280 | Ga0466723_012881 | 3300042618 | Bacteria | 17418 |
| 281 | Ga0466723_224577 | 3300042618 | Bacteria | 1746 |
| 282 | Ga0466723_275374 | 3300042618 | Bacteria | 7873 |
| 283 | Ga0466726_422078 | 3300042619 | Bacteria | 1964 |
| 284 | Ga0466726_469885 | 3300042619 | Unclassified | 1138 |
| 285 | Ga0466728_127900 | 3300042620 | Bacteria | 1986 |
| 286 | Ga0466729_047462 | 3300042621 | Bacteria | 1021 |
| 287 | Ga0466729_237167 | 3300042621 | Bacteria | 22788 |
| 288 | Ga0466735_024946 | 3300042624 | Bacteria | 1469 |
| 289 | Ga0466735_120740 | 3300042624 | Bacteria | 1099 |
| 290 | Ga0466735_214111 | 3300042624 | Bacteria | 1154 |
| 291 | Ga0466703_112854 | 3300042636 | Bacteria | 3363 |
| 292 | Ga0466704_311941 | 3300042643 | Unclassified | 1525 |
| 293 | Ga0466709_119890 | 3300042648 | Bacteria | 1100 |
| 294 | Ga0466708_201144 | 3300042652 | Bacteria | 3262 |
| 295 | Ga0466708_224455 | 3300042652 | Bacteria | 2640 |
| 296 | Ga0466727_035599 | 3300042655 | Bacteria | 1225 |
| 297 | Ga0466727_120852 | 3300042655 | Unclassified | 1611 |
| 298 | Ga0456237_0004866 | 3300041968 | Bacteria | 2148 |
| 299 | Ga0466691_191860 | 3300042593 | Bacteria | 6181 |
| 300 | Ga0466699_141767 | 3300042597 | Bacteria | 1314 |
| 301 | Ga0466706_287460 | 3300042599 | Archaea | 16748 |
| 302 | Ga0466707_003144 | 3300042601 | Unclassified | 1034 |
| 303 | Ga0466707_055489 | 3300042601 | Bacteria | 1110 |
| 304 | Ga0466713_034682 | 3300042602 | Bacteria | 11311 |
| 305 | Ga0466716_280004 | 3300042605 | Bacteria | 5357 |
| 306 | Ga0466716_452893 | 3300042605 | Bacteria | 2343 |
| 307 | Ga0123356_10315575 | 3300010049 | Bacteria | 1674 |
| 308 | Ga0123356_10567555 | 3300010049 | Bacteria | 1297 |
| 309 | Ga0123356_11982795 | 3300010049 | Bacteria | 726 |
| 310 | Ga0123356_12094993 | 3300010049 | Bacteria | 706 |
| 311 | Ga0123353_10048203 | 3300010167 | Bacteria | 6781 |
| 312 | Ga0123353_10245242 | 3300010167 | Bacteria | 2780 |
| 313 | Ga0123353_10597026 | 3300010167 | Bacteria | 1579 |
| 314 | Ga0123353_10618502 | 3300010167 | Bacteria | 1543 |
| 315 | Ga0123353_11826571 | 3300010167 | Bacteria | 754 |
| 316 | Ga0123353_12150315 | 3300010167 | Bacteria | 677 |
| 317 | Ga0123353_12475891 | 3300010167 | Bacteria | 618 |
| 318 | Ga0123354_10272919 | 3300010882 | Bacteria | 1660 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF09827 | CRISPR_Cas2 | CRISPR associated protein Cas2 | 16 | 93 | 0.98 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.