Protein Family IF07590
Metagenome
Isolate
117
Members
59
Samples
109
Scaffolds
391.33
Avg Length
Representative Sequence
- ID
- 3300042615|Ga0466711_502239|Ga0466711_502239_2653_3951
- Length
- 432 aa
- Sequence
- MLYSEEYNKNKYKRDFVIKIIYYICCINKTIVKTNSSKMKNMRLTELSELYKQELLRNIVPFWLTKSQDTQYGGYFTCLTKEGNVFDTDKFVWLQGRQVWMFSYLYTKVEKRPEWLECAVQGGEFLKKYGHDGHYNWYFSLNREGKPLIAPYNIFSYTFAAMAFGQLAIATGREEYAGIAKKTYDAILSRMSNPKGKWNKTVPGTRELKNFALPMILCNLSLEIEQLLDKETKEETVAACLHEILDVFWRPEIGLIVENVTADGNLSDSFDGRLTNPGHALEAMWFVMDLGVRLQRADLIRQAVEIALRMAEYGWDKQYGGIFYYMDRLGYPPQQLEWDQKLWWVHIEALVCMIKGYQLTGNEDCLKWFEKIHAYTWEHFKDREYPEWFGYLNRQGEVLLPLKGGKWKGCFHVPRGLYQCWKILEDTKEKNH
Sample Types
Isolate
6.8%
Metagenome
93.2%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
32.1%
Kalotermitidae
25.0%
Unclassified
8.9%
Rhinotermitidae
7.1%
Blattidae
7.1%
Armadillidiidae
5.4%
Termopsidae
5.4%
Culicidae
3.6%
Daphniidae
1.8%
Hodotermitidae
1.8%
Passalidae
1.8%
Taxonomy
Archaea
0
Bacteria
115
Eukaryota
0
Viruses
0
Unclassified
2
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 2 | 3300012832 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E6 MG | Metagenome | Culicidae |
| 3 | 3300012845 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG | Metagenome | Culicidae |
| 4 | 3300012848 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG | Metagenome | Armadillidiidae |
| 5 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 6 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 7 | 2590828803 | Pedobacter glucosidilyticus DD6b | Isolate | Daphniidae |
| 8 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 9 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 10 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 11 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 12 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 13 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 14 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 15 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 16 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 17 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 18 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 19 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 20 | 2910926975 | Dysgonomonas sp. 25 | Isolate | Blattidae |
| 21 | 3004667792 | Bacteroides sp. 519 | Isolate | Blattidae |
| 22 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 23 | 3300012814 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E6 MG | Metagenome | |
| 24 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 25 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 26 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 27 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 28 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 29 | 2820759988 | Unclassified Bacteroidetes Mp193P4bin4 | Isolate | Unclassified |
| 30 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 31 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 32 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 33 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 34 | 3300012829 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG | Metagenome | Armadillidiidae |
| 35 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 36 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 37 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 38 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 39 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 40 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 41 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 42 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 43 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 44 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 45 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 46 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 47 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 48 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 49 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 50 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 51 | 2830041218 | Bacteroides reticulotermitis DSM 105720 | Isolate | Unclassified |
| 52 | 2910942425 | Dysgonomonas sp. 521 | Isolate | Blattidae |
| 53 | 3004672520 | Bacteroides sp. 51 | Isolate | Blattidae |
| 54 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 55 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 56 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 57 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 58 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 59 | 8100166142 | Dysgonomonas sp. GY75 | Isolate | Rhinotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0123354_10230727 | 3300010882 | Bacteria | 1936 |
| 2 | Ga0466706_131146 | 3300042599 | Bacteria | 46092 |
| 3 | Ga0466714_072905 | 3300042603 | Bacteria | 26661 |
| 4 | Ga0466722_017995 | 3300042609 | Bacteria | 9703 |
| 5 | JGI24702J35022_10001120 | 3300002462 | Bacteria | 16637 |
| 6 | Ga0123357_10003280 | 3300009784 | Bacteria | 18456 |
| 7 | Ga0466734_021811 | 3300042623 | Bacteria | 3120 |
| 8 | Ga0466730_007163 | 3300042625 | Bacteria | 2549 |
| 9 | Ga0466725_210534 | 3300042654 | Bacteria | 19860 |
| 10 | Ga0466711_138130 | 3300042615 | Bacteria | 15142 |
| 11 | Ga0466728_433200 | 3300042620 | Bacteria | 2126 |
| 12 | Ga0123354_10019424 | 3300010882 | Bacteria | 10672 |
| 13 | Ga0466713_043330 | 3300042602 | Bacteria | 36121 |
| 14 | Ga0466713_045544 | 3300042602 | Bacteria | 37734 |
| 15 | Ga0466713_132502 | 3300042602 | Bacteria | 30273 |
| 16 | Ga0466716_184163 | 3300042605 | Bacteria | 3690 |
| 17 | Ga0160467_100017 | 3300012829 | Bacteria | 333132 |
| 18 | Ga0160443_100016 | 3300012848 | Bacteria | 435403 |
| 19 | Ga0265387_1005348 | 3300024582 | Bacteria | 1736 |
| 20 | Ga0466690_261233 | 3300042590 | Bacteria | 20412 |
| 21 | Ga0466692_108025 | 3300042591 | Bacteria | 12787 |
| 22 | Ga0466691_173679 | 3300042593 | Bacteria | 10823 |
| 23 | IMNBL1DRAFT_c0000758 | 3300000062 | Bacteria | 25498 |
| 24 | Ga0068305_10119908 | 3300005083 | Bacteria | 10428 |
| 25 | Ga0466729_255776 | 3300042621 | Bacteria | 12086 |
| 26 | Ga0466702_368164 | 3300042635 | Bacteria | 1869 |
| 27 | Ga0466705_429505 | 3300042612 | Bacteria | 17902 |
| 28 | Ga0123353_10109804 | 3300010167 | Bacteria | 4443 |
| 29 | Ga0466707_011154 | 3300042601 | Bacteria | 12186 |
| 30 | Ga0466714_070484 | 3300042603 | Bacteria | 3112 |
| 31 | Ga0466719_539963 | 3300042606 | Bacteria | 1230 |
| 32 | Ga0466697_020315 | 3300042611 | Bacteria | 2254 |
| 33 | Ga0160433_100046 | 3300012846 | Bacteria | 138039 |
| 34 | Ga0466692_026125 | 3300042591 | Bacteria | 30408 |
| 35 | Ga0466696_188557 | 3300042596 | Bacteria | 2209 |
| 36 | IMNBL1DRAFT_c0000444 | 3300000062 | Bacteria | 34756 |
| 37 | Ga0466734_125181 | 3300042623 | Bacteria | 3258 |
| 38 | Ga0466735_067769 | 3300042624 | Bacteria | 2201 |
| 39 | Ga0466703_091821 | 3300042636 | Bacteria | 20025 |
| 40 | Ga0466704_274767 | 3300042643 | Bacteria | 2488 |
| 41 | Ga0466709_097057 | 3300042648 | Bacteria | 50776 |
| 42 | Ga0466710_423632 | 3300042613 | Bacteria | 1927 |
| 43 | Ga0466711_219636 | 3300042615 | Bacteria | 15142 |
| 44 | Ga0466711_502239 | 3300042615 | Bacteria | 21969 |
| 45 | Ga0466726_180929 | 3300042619 | Bacteria | 1655 |
| 46 | Ga0123354_10024301 | 3300010882 | Bacteria | 9557 |
| 47 | Ga0160453_100001 | 3300012814 | Bacteria | 1272344 |
| 48 | Ga0160433_100778 | 3300012846 | Bacteria | 11596 |
| 49 | JGI24699J35502_11133912 | 3300002509 | Bacteria | 19082 |
| 50 | Ga0466730_061167 | 3300042625 | Bacteria | 1436 |
| 51 | Ga0466703_099655 | 3300042636 | Bacteria | 1917 |
| 52 | Ga0466704_443397 | 3300042643 | Bacteria | 15243 |
| 53 | Ga0466724_42296 | 3300042649 | Bacteria | 37541 |
| 54 | Ga0466708_180100 | 3300042652 | Bacteria | 18191 |
| 55 | Ga0466727_227583 | 3300042655 | Bacteria | 4388 |
| 56 | Ga0466733_054986 | 3300042659 | Bacteria | 147644 |
| 57 | Ga0466733_133481 | 3300042659 | Bacteria | 7548 |
| 58 | Ga0466733_194263 | 3300042659 | Bacteria | 5233 |
| 59 | Ga0123354_10155296 | 3300010882 | Bacteria | 2749 |
| 60 | Ga0466700_077915 | 3300042600 | Bacteria | 1725 |
| 61 | Ga0466713_000924 | 3300042602 | Bacteria | 29055 |
| 62 | Ga0466719_165396 | 3300042606 | Bacteria | 5602 |
| 63 | Ga0466722_052851 | 3300042609 | Bacteria | 18802 |
| 64 | Ga0466722_092435 | 3300042609 | Bacteria | 11858 |
| 65 | Ga0160460_100041 | 3300012845 | Bacteria | 258343 |
| 66 | Ga0466696_060600 | 3300042596 | Bacteria | 24671 |
| 67 | Ga0068305_10018466 | 3300005083 | Bacteria | 33580 |
| 68 | Ga0466703_231744 | 3300042636 | Unclassified | 1460 |
| 69 | Ga0466704_243226 | 3300042643 | Bacteria | 34984 |
| 70 | Ga0466727_338846 | 3300042655 | Bacteria | 9472 |
| 71 | Ga0466733_014441 | 3300042659 | Bacteria | 42619 |
| 72 | Ga0466715_503623 | 3300042616 | Bacteria | 6489 |
| 73 | Ga0466728_030881 | 3300042620 | Bacteria | 17351 |
| 74 | Ga0123356_10280715 | 3300010049 | Bacteria | 1760 |
| 75 | Ga0123354_10004837 | 3300010882 | Bacteria | 19279 |
| 76 | Ga0466700_142102 | 3300042600 | Bacteria | 9859 |
| 77 | Ga0466713_118123 | 3300042602 | Bacteria | 66356 |
| 78 | Ga0466692_091832 | 3300042591 | Bacteria | 55079 |
| 79 | Ga0466692_119192 | 3300042591 | Bacteria | 32183 |
| 80 | JGI24705J35276_12229062 | 3300002504 | Bacteria | 3310 |
| 81 | Ga0466705_091086 | 3300042612 | Bacteria | 21348 |
| 82 | Ga0466735_108542 | 3300042624 | Bacteria | 12812 |
| 83 | Ga0466703_060020 | 3300042636 | Bacteria | 14615 |
| 84 | Ga0466709_168950 | 3300042648 | Bacteria | 102495 |
| 85 | Ga0466733_071356 | 3300042659 | Bacteria | 1978 |
| 86 | Ga0466715_297130 | 3300042616 | Bacteria | 17908 |
| 87 | Ga0466715_508115 | 3300042616 | Bacteria | 18878 |
| 88 | Ga0466723_156079 | 3300042618 | Bacteria | 24217 |
| 89 | Ga0123357_10009865 | 3300009784 | Bacteria | 12087 |
| 90 | Ga0160458_100095 | 3300012832 | Unclassified | 94031 |
| 91 | Ga0466691_097756 | 3300042593 | Bacteria | 14455 |
| 92 | Ga0466704_006673 | 3300042643 | Bacteria | 8438 |
| 93 | Ga0466710_014956 | 3300042613 | Bacteria | 24133 |
| 94 | Ga0466715_053183 | 3300042616 | Bacteria | 32898 |
| 95 | Ga0466715_349023 | 3300042616 | Bacteria | 10633 |
| 96 | Ga0123353_10149885 | 3300010167 | Bacteria | 3725 |
| 97 | Ga0466706_092414 | 3300042599 | Bacteria | 5687 |
| 98 | Ga0466713_112803 | 3300042602 | Bacteria | 145809 |
| 99 | Ga0466713_123288 | 3300042602 | Bacteria | 76789 |
| 100 | Ga0466719_550930 | 3300042606 | Bacteria | 1265 |
| 101 | Ga0466722_040015 | 3300042609 | Bacteria | 18144 |
| 102 | Ga0466698_369917 | 3300042610 | Bacteria | 2533 |
| 103 | IMNBL1DRAFT_c0028109 | 3300000062 | Bacteria | 2103 |
| 104 | Ga0072941_1084043 | 3300005201 | Bacteria | 14677 |
| 105 | Ga0466729_307144 | 3300042621 | Bacteria | 15861 |
| 106 | Ga0466704_195324 | 3300042643 | Bacteria | 28584 |
| 107 | Ga0466709_026512 | 3300042648 | Bacteria | 33059 |
| 108 | Ga0466708_332394 | 3300042652 | Bacteria | 14864 |
| 109 | Ga0466727_336852 | 3300042655 | Bacteria | 1263 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF07221 | GlcNAc_2-epim | N-acylglucosamine 2-epimerase (GlcNAc 2-epimerase) | 74 | 408 | 0.92 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF07221 | GO:0016853 | isomerase activity | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.