Protein Family IF07495
Metagenome
Isolate
326
Members
96
Samples
283
Scaffolds
427.74
Avg Length
Representative Sequence
- ID
- 3300042615|Ga0466711_143800|Ga0466711_143800_1241_2746
- Length
- 501 aa
- Sequence
- MSSTEKKNYLLPIIMMIALFAMISFVTGLPNPMGVIVKNQFGASNFMSQLGNAANFIAYAFMGLPAGLLLQRIGYKKTALAAIVIGFTGVGVQYLSGLAGSFAVYLAGAFVSGFSMCMLNTVVNPMLNTLGSGGKKGNQLIQIGGTFNSLSATIVPVLVGYFIGNAVRPSIKDANPALFIAMGIFAIVFIVLLLMNIPEPHMVKEVKSKEKSKYSPLSFRHFILGAVAIFVYVGVEVGIPNISNLFMTTKTTEQFAAYEQEYMRQKNDQEYLVQIKAEADKAVAEAEAARVANAPDLKEKVELAKKADSKVISEEEYLKAKEVKIPGLGMDPVTAGSVVGTYWFLMLLGRLVVGASLGARISSKSMLSAASLAGLVFVLLAIFIPTSTTVSMPVFQSDISFGLAQVPISIMFLILCGLCTSIMWGGIFNLAVEGLGKFTAAASGIFMVMVCGGGVLPLIQGGIADSVSYMASFWVIFVGLAYLLFYALIGSKNVNTNIPVE
Sample Types
Isolate
13.2%
Metagenome
86.8%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Blattidae
27.1%
Termitidae
21.9%
Unclassified
16.7%
Kalotermitidae
14.6%
Rhinotermitidae
5.2%
Formicidae
5.2%
Passalidae
3.1%
Termopsidae
3.1%
Hydrophilidae
2.1%
Hodotermitidae
1.0%
Taxonomy
Archaea
1
Bacteria
310
Eukaryota
0
Viruses
0
Unclassified
15
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2225789003 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) | Metagenome | Passalidae |
| 2 | 2830041218 | Bacteroides reticulotermitis DSM 105720 | Isolate | Unclassified |
| 3 | 2910930387 | Dysgonomonas sp. 216 | Isolate | Blattidae |
| 4 | 2910942425 | Dysgonomonas sp. 521 | Isolate | Blattidae |
| 5 | 2940212447 | Parabacteroides sp. PH5-16 | Isolate | Blattidae |
| 6 | 2940302308 | Parabacteroides sp. PF5-5 | Isolate | Blattidae |
| 7 | 2940321370 | Parabacteroides sp. PH5-39 | Isolate | Blattidae |
| 8 | 2940332795 | Parabacteroides sp. PH5-8 | Isolate | Blattidae |
| 9 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 10 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 11 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 12 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 13 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 14 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 15 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 16 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 17 | 2920168565 | Paludibacter sp. 221 | Isolate | Blattidae |
| 18 | 2940205530 | Parabacteroides sp. PH5-33 | Isolate | Blattidae |
| 19 | 2940216256 | Dysgonomonadaceae bacterium PH5-43 | Isolate | Blattidae |
| 20 | 2940317558 | Parabacteroides sp. PH5-26 | Isolate | Blattidae |
| 21 | 2940325180 | Parabacteroides sp. PH5-41 | Isolate | Blattidae |
| 22 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 23 | 2820751898 | Unclassified Bacteroidetes Nc150P4bin22 | Isolate | Unclassified |
| 24 | 2820757377 | Unclassified Bacteroidetes Mp193P4bin6 | Isolate | Unclassified |
| 25 | 2873610414 | Dysgonomonas sp. HDW5B | Isolate | Hydrophilidae |
| 26 | 2940202316 | Parabacteroides sp. PF5-9 | Isolate | Blattidae |
| 27 | 2940371297 | Parabacteroides sp. PM5-20 | Isolate | Blattidae |
| 28 | 2967483437 | Candidatus Ordinivivax streblomastigis St1 | Isolate | Unclassified |
| 29 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 30 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 31 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 32 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 33 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 34 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 35 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 36 | 2940195863 | Parabacteroides sp. PF5-6 | Isolate | Blattidae |
| 37 | 2940298504 | Parabacteroides sp. PF5-13 | Isolate | Blattidae |
| 38 | 2940336608 | Dysgonomonas sp. PH5-37 | Isolate | Blattidae |
| 39 | 3004667792 | Bacteroides sp. 519 | Isolate | Blattidae |
| 40 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 41 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 42 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 43 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 44 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 45 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 46 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 47 | 2820772500 | Unclassified Bacteroidetes Lab288P1bin72 | Isolate | Unclassified |
| 48 | 2873600114 | Dysgonomonas sp. HDW5A | Isolate | Hydrophilidae |
| 49 | 2940193328 | Dysgonomonas sp. PH5-45 | Isolate | Blattidae |
| 50 | 3004677695 | Bacteroides sp. 214 | Isolate | Blattidae |
| 51 | 3300007068 | Ant gut microbial communities from Cephalotes simillimus, Peru | Metagenome | Formicidae |
| 52 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 53 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 54 | 2820746860 | Unclassified Bacteroidetes Th196P3bin126 | Isolate | Unclassified |
| 55 | 2820759988 | Unclassified Bacteroidetes Mp193P4bin4 | Isolate | Unclassified |
| 56 | 2910949487 | Dysgonomonas sp. 520 | Isolate | Blattidae |
| 57 | 2923982719 | Parabacteroides sp. 52 | Isolate | Blattidae |
| 58 | 2940306115 | Parabacteroides sp. PFB2-22 | Isolate | Blattidae |
| 59 | 2940309933 | Parabacteroides sp. PH5-13 | Isolate | Blattidae |
| 60 | 2940328985 | Parabacteroides sp. PH5-46 | Isolate | Blattidae |
| 61 | 3300007052 | Ant gut microbial communities from Cephalotes eduarduli, Brazil | Metagenome | Formicidae |
| 62 | 3300007190 | Ant gut microbial communities from Cephalotes umbraculatus, Peru | Metagenome | Formicidae |
| 63 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 64 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 65 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 66 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 67 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 68 | 8100157865 | Dysgonomonas sp. GY617 | Isolate | Rhinotermitidae |
| 69 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 70 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 71 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 72 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 73 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 74 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 75 | 2609459943 | Bacteroides reticulotermitis JCM 10512 | Isolate | Rhinotermitidae |
| 76 | 2695420314 | Dysgonomonas sp. BGC7 | Isolate | Unclassified |
| 77 | 2820767225 | Unclassified Bacteroidetes Lab288P3bin34 | Isolate | Unclassified |
| 78 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 79 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 80 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 81 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 82 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 83 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 84 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 85 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 86 | 2695420317 | Dysgonomonas sp. HGC4 | Isolate | Unclassified |
| 87 | 2820748953 | Unclassified Bacteroidetes Nt197P4bin17 | Isolate | Unclassified |
| 88 | 2820768849 | Unclassified Bacteroidetes Lab288P3bin194 | Isolate | Unclassified |
| 89 | 2820774381 | Unclassified Bacteroidetes Lab288P1bin37 | Isolate | Unclassified |
| 90 | 2922326829 | Bacteroides sp. 224 | Isolate | Blattidae |
| 91 | 2940313741 | Parabacteroides sp. PH5-17 | Isolate | Blattidae |
| 92 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 93 | 3300007188 | Ant gut microbial communities from Cephalotes rohweri, Arizona, USA | Metagenome | Formicidae |
| 94 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 95 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 96 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466733_042381 | 3300042659 | Bacteria | 10868 |
| 2 | Ga0466711_047850 | 3300042615 | Bacteria | 7357 |
| 3 | Ga0466711_420180 | 3300042615 | Bacteria | 7135 |
| 4 | Ga0466715_159482 | 3300042616 | Bacteria | 5990 |
| 5 | Ga0466715_181089 | 3300042616 | Bacteria | 15777 |
| 6 | Ga0466723_307687 | 3300042618 | Bacteria | 24942 |
| 7 | Ga0466726_381700 | 3300042619 | Bacteria | 15361 |
| 8 | Ga0466729_028618 | 3300042621 | Bacteria | 2494 |
| 9 | Ga0466690_082186 | 3300042590 | Bacteria | 7430 |
| 10 | Ga0466692_196455 | 3300042591 | Bacteria | 23185 |
| 11 | Ga0466696_286046 | 3300042596 | Bacteria | 11686 |
| 12 | Ga0123353_10177816 | 3300010167 | Bacteria | 3372 |
| 13 | Ga0123354_10226419 | 3300010882 | Bacteria | 1969 |
| 14 | Ga0466700_030199 | 3300042600 | Bacteria | 1406 |
| 15 | Ga0466707_042036 | 3300042601 | Bacteria | 5533 |
| 16 | Ga0466713_043697 | 3300042602 | Bacteria | 3590 |
| 17 | Ga0466713_050637 | 3300042602 | Bacteria | 28833 |
| 18 | Ga0466716_312817 | 3300042605 | Bacteria | 2021 |
| 19 | Ga0466716_425109 | 3300042605 | Bacteria | 17659 |
| 20 | Ga0466735_059574 | 3300042624 | Bacteria | 3224 |
| 21 | Ga0466735_228111 | 3300042624 | Bacteria | 1607 |
| 22 | Ga0466703_084924 | 3300042636 | Bacteria | 7752 |
| 23 | Ga0466704_379629 | 3300042643 | Bacteria | 8643 |
| 24 | Ga0466709_366797 | 3300042648 | Bacteria | 2846 |
| 25 | 2226986796 | 2225789003 | Bacteria | 1708 |
| 26 | IMNBL1DRAFT_c0010608 | 3300000062 | Bacteria | 4384 |
| 27 | Ga0068305_10028414 | 3300005083 | Unclassified | 6313 |
| 28 | Ga0123357_10000582 | 3300009784 | Bacteria | 36115 |
| 29 | Ga0466705_131015 | 3300042612 | Bacteria | 1852 |
| 30 | Ga0466705_293761 | 3300042612 | Unclassified | 1669 |
| 31 | Ga0466733_146045 | 3300042659 | Bacteria | 46100 |
| 32 | Ga0466733_218689 | 3300042659 | Bacteria | 1769 |
| 33 | Ga0466715_596959 | 3300042616 | Bacteria | 12515 |
| 34 | Ga0466723_034385 | 3300042618 | Bacteria | 31971 |
| 35 | Ga0466723_105020 | 3300042618 | Bacteria | 3811 |
| 36 | Ga0466657_068251 | 3300042582 | Bacteria | 20125 |
| 37 | Ga0466690_071416 | 3300042590 | Bacteria | 9129 |
| 38 | Ga0466692_068966 | 3300042591 | Bacteria | 43940 |
| 39 | Ga0123357_10010522 | 3300009784 | Bacteria | 11774 |
| 40 | Ga0123356_10026869 | 3300010049 | Bacteria | 5398 |
| 41 | Ga0123356_10113076 | 3300010049 | Bacteria | 2626 |
| 42 | Ga0123356_10244291 | 3300010049 | Bacteria | 1868 |
| 43 | Ga0123353_10026616 | 3300010167 | Bacteria | 8841 |
| 44 | Ga0123354_10205156 | 3300010882 | Bacteria | 2152 |
| 45 | Ga0123354_10215841 | 3300010882 | Bacteria | 2056 |
| 46 | Ga0466706_056869 | 3300042599 | Bacteria | 16059 |
| 47 | Ga0466706_071731 | 3300042599 | Bacteria | 3362 |
| 48 | Ga0466714_053706 | 3300042603 | Bacteria | 3203 |
| 49 | Ga0466698_484167 | 3300042610 | Bacteria | 2635 |
| 50 | Ga0466703_378651 | 3300042636 | Bacteria | 11437 |
| 51 | Ga0466704_002550 | 3300042643 | Bacteria | 1796 |
| 52 | Ga0466709_389355 | 3300042648 | Bacteria | 5003 |
| 53 | Ga0466708_127910 | 3300042652 | Bacteria | 13451 |
| 54 | Ga0466727_057394 | 3300042655 | Bacteria | 2465 |
| 55 | Ga0466727_259057 | 3300042655 | Bacteria | 2658 |
| 56 | 2227529891 | 2225789004 | Bacteria | 3174 |
| 57 | JGI24705J35276_12236088 | 3300002504 | Bacteria | 7448 |
| 58 | Ga0103265_1000024 | 3300007068 | Bacteria | 23023 |
| 59 | Ga0466697_165431 | 3300042611 | Bacteria | 1442 |
| 60 | Ga0466733_217448 | 3300042659 | Bacteria | 4745 |
| 61 | Ga0466711_143800 | 3300042615 | Bacteria | 6227 |
| 62 | Ga0466718_034099 | 3300042617 | Bacteria | 2607 |
| 63 | Ga0466726_060357 | 3300042619 | Bacteria | 8842 |
| 64 | Ga0466726_165258 | 3300042619 | Bacteria | 1875 |
| 65 | Ga0466728_073725 | 3300042620 | Bacteria | 64638 |
| 66 | Ga0466728_203310 | 3300042620 | Bacteria | 5424 |
| 67 | Ga0466657_315733 | 3300042582 | Bacteria | 6609 |
| 68 | Ga0466696_248485 | 3300042596 | Unclassified | 3291 |
| 69 | Ga0123357_10010939 | 3300009784 | Bacteria | 11585 |
| 70 | Ga0123356_10133649 | 3300010049 | Bacteria | 2435 |
| 71 | Ga0123353_10028381 | 3300010167 | Bacteria | 8597 |
| 72 | Ga0123354_10132389 | 3300010882 | Bacteria | 3141 |
| 73 | Ga0466701_058955 | 3300042598 | Bacteria | 26869 |
| 74 | Ga0466706_247892 | 3300042599 | Bacteria | 15362 |
| 75 | Ga0466707_085455 | 3300042601 | Bacteria | 21640 |
| 76 | Ga0466707_216378 | 3300042601 | Bacteria | 13824 |
| 77 | Ga0466713_072600 | 3300042602 | Bacteria | 14947 |
| 78 | Ga0466714_087014 | 3300042603 | Bacteria | 12878 |
| 79 | Ga0466719_103504 | 3300042606 | Bacteria | 4830 |
| 80 | Ga0466722_086226 | 3300042609 | Bacteria | 13655 |
| 81 | Ga0466722_175320 | 3300042609 | Bacteria | 5187 |
| 82 | Ga0466722_243095 | 3300042609 | Bacteria | 3323 |
| 83 | Ga0466729_254764 | 3300042621 | Bacteria | 8542 |
| 84 | Ga0466735_126718 | 3300042624 | Bacteria | 3088 |
| 85 | Ga0466704_089145 | 3300042643 | Bacteria | 13225 |
| 86 | Ga0466704_250980 | 3300042643 | Bacteria | 4870 |
| 87 | Ga0466708_148683 | 3300042652 | Bacteria | 8019 |
| 88 | Ga0466708_321468 | 3300042652 | Bacteria | 1442 |
| 89 | Ga0466727_047375 | 3300042655 | Bacteria | 1426 |
| 90 | 2227096380 | 2225789004 | Bacteria | 1812 |
| 91 | IMNBL1DRAFT_c0000093 | 3300000062 | Bacteria | 77928 |
| 92 | IMNBL1DRAFT_c0000149 | 3300000062 | Bacteria | 62726 |
| 93 | JGI24702J35022_10002155 | 3300002462 | Bacteria | 12143 |
| 94 | Ga0068305_10052565 | 3300005083 | Bacteria | 15214 |
| 95 | Ga0102734_1000031 | 3300007129 | Bacteria | 55117 |
| 96 | Ga0103264_1000036 | 3300007188 | Bacteria | 135516 |
| 97 | Ga0466733_030153 | 3300042659 | Unclassified | 3324 |
| 98 | Ga0466733_110329 | 3300042659 | Bacteria | 2312 |
| 99 | Ga0466715_115457 | 3300042616 | Bacteria | 36939 |
| 100 | Ga0466715_257264 | 3300042616 | Bacteria | 11253 |
| 101 | Ga0466715_315798 | 3300042616 | Bacteria | 3955 |
| 102 | Ga0466715_444863 | 3300042616 | Bacteria | 4531 |
| 103 | Ga0466723_212262 | 3300042618 | Bacteria | 19907 |
| 104 | Ga0466728_097882 | 3300042620 | Unclassified | 2206 |
| 105 | Ga0466690_078594 | 3300042590 | Bacteria | 2371 |
| 106 | Ga0466692_016417 | 3300042591 | Bacteria | 4127 |
| 107 | Ga0466692_194321 | 3300042591 | Bacteria | 22107 |
| 108 | Ga0466691_047346 | 3300042593 | Bacteria | 83606 |
| 109 | Ga0466696_045091 | 3300042596 | Bacteria | 15483 |
| 110 | Ga0123354_10023133 | 3300010882 | Bacteria | 9801 |
| 111 | Ga0466706_006995 | 3300042599 | Bacteria | 7481 |
| 112 | Ga0466706_134861 | 3300042599 | Bacteria | 19873 |
| 113 | Ga0466714_020370 | 3300042603 | Bacteria | 64985 |
| 114 | Ga0466714_154944 | 3300042603 | Bacteria | 103066 |
| 115 | Ga0466716_339778 | 3300042605 | Bacteria | 2054 |
| 116 | Ga0466719_015535 | 3300042606 | Bacteria | 7304 |
| 117 | Ga0466719_064432 | 3300042606 | Bacteria | 10035 |
| 118 | Ga0466719_120227 | 3300042606 | Bacteria | 11923 |
| 119 | Ga0466719_561741 | 3300042606 | Bacteria | 10342 |
| 120 | Ga0466722_067773 | 3300042609 | Bacteria | 4097 |
| 121 | Ga0466729_300145 | 3300042621 | Bacteria | 2477 |
| 122 | Ga0466735_112855 | 3300042624 | Bacteria | 2475 |
| 123 | Ga0466704_039292 | 3300042643 | Bacteria | 5272 |
| 124 | Ga0466704_078614 | 3300042643 | Bacteria | 12503 |
| 125 | Ga0466704_084952 | 3300042643 | Bacteria | 35123 |
| 126 | Ga0466708_028614 | 3300042652 | Unclassified | 4545 |
| 127 | Ga0466708_033497 | 3300042652 | Bacteria | 2183 |
| 128 | Ga0466727_173858 | 3300042655 | Bacteria | 64235 |
| 129 | JGI24702J35022_10002794 | 3300002462 | Bacteria | 10585 |
| 130 | JGI24699J35502_11134165 | 3300002509 | Bacteria | 42441 |
| 131 | Ga0466705_270858 | 3300042612 | Bacteria | 8495 |
| 132 | Ga0466733_003696 | 3300042659 | Bacteria | 1612 |
| 133 | Ga0466733_047292 | 3300042659 | Bacteria | 1670 |
| 134 | Ga0466733_074294 | 3300042659 | Bacteria | 93274 |
| 135 | Ga0466733_186467 | 3300042659 | Bacteria | 27653 |
| 136 | Ga0466715_157136 | 3300042616 | Bacteria | 21139 |
| 137 | Ga0466715_271419 | 3300042616 | Bacteria | 13237 |
| 138 | Ga0466715_355501 | 3300042616 | Bacteria | 4162 |
| 139 | Ga0466715_400161 | 3300042616 | Bacteria | 8851 |
| 140 | Ga0466715_410857 | 3300042616 | Bacteria | 5704 |
| 141 | Ga0466726_016234 | 3300042619 | Bacteria | 5109 |
| 142 | Ga0466728_107095 | 3300042620 | Bacteria | 1671 |
| 143 | Ga0466690_086675 | 3300042590 | Bacteria | 50714 |
| 144 | Ga0466690_241144 | 3300042590 | Unclassified | 5992 |
| 145 | Ga0466692_188243 | 3300042591 | Bacteria | 86416 |
| 146 | Ga0466691_223368 | 3300042593 | Bacteria | 4590 |
| 147 | Ga0466696_007849 | 3300042596 | Bacteria | 54852 |
| 148 | Ga0466696_158888 | 3300042596 | Bacteria | 12492 |
| 149 | Ga0466696_176991 | 3300042596 | Bacteria | 3204 |
| 150 | Ga0466696_221228 | 3300042596 | Bacteria | 3581 |
| 151 | Ga0466696_322497 | 3300042596 | Bacteria | 13119 |
| 152 | Ga0123356_10036098 | 3300010049 | Bacteria | 4616 |
| 153 | Ga0123353_10000136 | 3300010167 | Bacteria | 89026 |
| 154 | Ga0123353_10381465 | 3300010167 | Bacteria | 2108 |
| 155 | Ga0466706_068424 | 3300042599 | Bacteria | 45002 |
| 156 | Ga0466707_014229 | 3300042601 | Bacteria | 20609 |
| 157 | Ga0466713_002492 | 3300042602 | Bacteria | 2032 |
| 158 | Ga0466713_102671 | 3300042602 | Bacteria | 2275 |
| 159 | Ga0466714_013319 | 3300042603 | Bacteria | 54625 |
| 160 | Ga0466722_251493 | 3300042609 | Bacteria | 54791 |
| 161 | Ga0466735_068503 | 3300042624 | Bacteria | 3783 |
| 162 | Ga0466703_071102 | 3300042636 | Bacteria | 7949 |
| 163 | Ga0466703_075665 | 3300042636 | Bacteria | 2617 |
| 164 | Ga0466703_264650 | 3300042636 | Bacteria | 6179 |
| 165 | Ga0466703_363815 | 3300042636 | Bacteria | 9064 |
| 166 | Ga0466704_140628 | 3300042643 | Bacteria | 15835 |
| 167 | Ga0466704_480030 | 3300042643 | Bacteria | 3946 |
| 168 | Ga0466709_100567 | 3300042648 | Bacteria | 1464 |
| 169 | Ga0466709_304202 | 3300042648 | Bacteria | 34829 |
| 170 | Ga0466709_305666 | 3300042648 | Bacteria | 1626 |
| 171 | Ga0466708_027055 | 3300042652 | Bacteria | 23914 |
| 172 | 2227489660 | 2225789004 | Bacteria | 4126 |
| 173 | IMNBL1DRAFT_c0017872 | 3300000062 | Bacteria | 2966 |
| 174 | JGI24699J35502_11134075 | 3300002509 | Bacteria | 28429 |
| 175 | Ga0102736_1000238 | 3300007052 | Unclassified | 16121 |
| 176 | Ga0466733_192441 | 3300042659 | Bacteria | 8083 |
| 177 | Ga0466710_058619 | 3300042613 | Bacteria | 5593 |
| 178 | Ga0466711_168100 | 3300042615 | Bacteria | 15409 |
| 179 | Ga0466711_340964 | 3300042615 | Bacteria | 8953 |
| 180 | Ga0466726_166727 | 3300042619 | Bacteria | 1917 |
| 181 | Ga0466728_065619 | 3300042620 | Bacteria | 98744 |
| 182 | Ga0466728_108137 | 3300042620 | Unclassified | 2921 |
| 183 | Ga0466729_072975 | 3300042621 | Unclassified | 5519 |
| 184 | Ga0466690_007268 | 3300042590 | Bacteria | 15926 |
| 185 | Ga0466690_080367 | 3300042590 | Bacteria | 8109 |
| 186 | Ga0466690_248589 | 3300042590 | Unclassified | 2338 |
| 187 | Ga0466690_350451 | 3300042590 | Bacteria | 1652 |
| 188 | Ga0466690_393883 | 3300042590 | Bacteria | 1429 |
| 189 | Ga0466692_168570 | 3300042591 | Bacteria | 17411 |
| 190 | Ga0123357_10022969 | 3300009784 | Bacteria | 8371 |
| 191 | Ga0123353_10000162 | 3300010167 | Bacteria | 85033 |
| 192 | Ga0123353_10113954 | 3300010167 | Bacteria | 4352 |
| 193 | Ga0123353_10252017 | 3300010167 | Bacteria | 2733 |
| 194 | Ga0123353_10326082 | 3300010167 | Bacteria | 2327 |
| 195 | Ga0123353_10463837 | 3300010167 | Bacteria | 1860 |
| 196 | Ga0123353_10559423 | 3300010167 | Bacteria | 1647 |
| 197 | Ga0466713_123886 | 3300042602 | Bacteria | 17149 |
| 198 | Ga0466716_043422 | 3300042605 | Bacteria | 9090 |
| 199 | Ga0466722_166491 | 3300042609 | Bacteria | 6972 |
| 200 | Ga0466722_266178 | 3300042609 | Bacteria | 3291 |
| 201 | Ga0466729_318175 | 3300042621 | Bacteria | 1392 |
| 202 | Ga0466735_061910 | 3300042624 | Unclassified | 2477 |
| 203 | Ga0466735_091444 | 3300042624 | Bacteria | 2924 |
| 204 | Ga0466703_417492 | 3300042636 | Bacteria | 3874 |
| 205 | Ga0466704_002372 | 3300042643 | Bacteria | 57196 |
| 206 | Ga0466704_045707 | 3300042643 | Bacteria | 13124 |
| 207 | Ga0466709_363785 | 3300042648 | Bacteria | 41688 |
| 208 | Ga0466708_028687 | 3300042652 | Bacteria | 5263 |
| 209 | Ga0466708_221268 | 3300042652 | Bacteria | 13982 |
| 210 | Ga0466708_320806 | 3300042652 | Bacteria | 1613 |
| 211 | Ga0466725_124603 | 3300042654 | Bacteria | 11186 |
| 212 | Ga0466727_189212 | 3300042655 | Bacteria | 2579 |
| 213 | IMNBL1DRAFT_c0002253 | 3300000062 | Bacteria | 13587 |
| 214 | IMNBL1DRAFT_c0028386 | 3300000062 | Bacteria | 2088 |
| 215 | JGI24705J35276_12235290 | 3300002504 | Bacteria | 6369 |
| 216 | Ga0068305_10114351 | 3300005083 | Unclassified | 3707 |
| 217 | Ga0466697_106599 | 3300042611 | Bacteria | 91903 |
| 218 | Ga0466705_275493 | 3300042612 | Bacteria | 5076 |
| 219 | Ga0466733_108515 | 3300042659 | Bacteria | 44584 |
| 220 | Ga0466712_095533 | 3300042614 | Unclassified | 2112 |
| 221 | Ga0466723_046824 | 3300042618 | Bacteria | 57163 |
| 222 | Ga0466726_064395 | 3300042619 | Bacteria | 25606 |
| 223 | Ga0466728_082257 | 3300042620 | Bacteria | 106309 |
| 224 | Ga0466729_085721 | 3300042621 | Bacteria | 4355 |
| 225 | Ga0466656_008367 | 3300042550 | Bacteria | 15930 |
| 226 | Ga0466693_099652 | 3300042592 | Bacteria | 4507 |
| 227 | Ga0466691_113952 | 3300042593 | Bacteria | 6351 |
| 228 | Ga0466691_134901 | 3300042593 | Bacteria | 8663 |
| 229 | Ga0123355_10004769 | 3300009826 | Bacteria | 19733 |
| 230 | Ga0123354_10002011 | 3300010882 | Bacteria | 26142 |
| 231 | Ga0123354_10007441 | 3300010882 | Bacteria | 16489 |
| 232 | Ga0123354_10224573 | 3300010882 | Bacteria | 1983 |
| 233 | Ga0123354_10231461 | 3300010882 | Bacteria | 1930 |
| 234 | Ga0123354_10303003 | 3300010882 | Bacteria | 1508 |
| 235 | Ga0466707_118656 | 3300042601 | Bacteria | 4478 |
| 236 | Ga0466713_112493 | 3300042602 | Bacteria | 23866 |
| 237 | Ga0466714_005444 | 3300042603 | Bacteria | 13480 |
| 238 | Ga0466714_135138 | 3300042603 | Bacteria | 3262 |
| 239 | Ga0466716_263613 | 3300042605 | Bacteria | 11222 |
| 240 | Ga0466722_158513 | 3300042609 | Bacteria | 9976 |
| 241 | Ga0466708_089470 | 3300042652 | Bacteria | 12012 |
| 242 | Ga0466708_210110 | 3300042652 | Bacteria | 8557 |
| 243 | Ga0466727_040552 | 3300042655 | Bacteria | 9696 |
| 244 | 2227080826 | 2225789004 | Bacteria | 10109 |
| 245 | 2227571856 | 2225789004 | Bacteria | 13833 |
| 246 | JGI24702J35022_10058751 | 3300002462 | Bacteria | 2054 |
| 247 | JGI24705J35276_12220424 | 3300002504 | Archaea | 2267 |
| 248 | JGI24699J35502_11134060 | 3300002509 | Bacteria | 27589 |
| 249 | JGI24699J35502_11134209 | 3300002509 | Bacteria | 59622 |
| 250 | Ga0103267_1000287 | 3300007190 | Bacteria | 22317 |
| 251 | Ga0466697_254053 | 3300042611 | Bacteria | 1922 |
| 252 | Ga0466705_106114 | 3300042612 | Bacteria | 1544 |
| 253 | Ga0466705_117204 | 3300042612 | Bacteria | 13174 |
| 254 | Ga0466733_103970 | 3300042659 | Bacteria | 6234 |
| 255 | Ga0466715_638688 | 3300042616 | Bacteria | 40279 |
| 256 | Ga0466723_186440 | 3300042618 | Bacteria | 54567 |
| 257 | Ga0466726_494144 | 3300042619 | Unclassified | 1620 |
| 258 | Ga0466728_093166 | 3300042620 | Bacteria | 80427 |
| 259 | Ga0466728_399272 | 3300042620 | Bacteria | 209367 |
| 260 | Ga0466657_006320 | 3300042582 | Bacteria | 6615 |
| 261 | Ga0466696_110169 | 3300042596 | Bacteria | 19494 |
| 262 | Ga0466696_237547 | 3300042596 | Bacteria | 21193 |
| 263 | Ga0466696_373365 | 3300042596 | Bacteria | 17016 |
| 264 | Ga0123357_10047865 | 3300009784 | Bacteria | 5794 |
| 265 | Ga0123354_10211914 | 3300010882 | Bacteria | 2090 |
| 266 | Ga0466700_156172 | 3300042600 | Bacteria | 109805 |
| 267 | Ga0466707_069345 | 3300042601 | Bacteria | 26773 |
| 268 | Ga0466707_100948 | 3300042601 | Bacteria | 4441 |
| 269 | Ga0466716_431812 | 3300042605 | Bacteria | 8551 |
| 270 | Ga0466719_041272 | 3300042606 | Bacteria | 2247 |
| 271 | Ga0466719_557299 | 3300042606 | Bacteria | 3148 |
| 272 | Ga0466722_027573 | 3300042609 | Bacteria | 5095 |
| 273 | Ga0466698_317799 | 3300042610 | Bacteria | 1588 |
| 274 | Ga0466729_289649 | 3300042621 | Bacteria | 6683 |
| 275 | Ga0466703_405707 | 3300042636 | Bacteria | 7807 |
| 276 | Ga0466704_045880 | 3300042643 | Bacteria | 5575 |
| 277 | Ga0466704_049264 | 3300042643 | Bacteria | 21976 |
| 278 | Ga0466704_193450 | 3300042643 | Bacteria | 17342 |
| 279 | Ga0466709_003568 | 3300042648 | Bacteria | 9102 |
| 280 | Ga0466709_299886 | 3300042648 | Bacteria | 3447 |
| 281 | Ga0466727_044786 | 3300042655 | Bacteria | 8421 |
| 282 | IMNBL1DRAFT_c0000345 | 3300000062 | Bacteria | 39398 |
| 283 | IMNBL1DRAFT_c0002512 | 3300000062 | Bacteria | 12709 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF07690 | MFS_1 | Major Facilitator Superfamily | 328 | 485 | 0.81 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.