Protein Family IF07495

Metagenome Isolate
326 Members
96 Samples
283 Scaffolds
427.74 Avg Length

🧬 Representative Sequence

ID
3300042615|Ga0466711_143800|Ga0466711_143800_1241_2746
Length
501 aa
Sequence
MSSTEKKNYLLPIIMMIALFAMISFVTGLPNPMGVIVKNQFGASNFMSQLGNAANFIAYAFMGLPAGLLLQRIGYKKTALAAIVIGFTGVGVQYLSGLAGSFAVYLAGAFVSGFSMCMLNTVVNPMLNTLGSGGKKGNQLIQIGGTFNSLSATIVPVLVGYFIGNAVRPSIKDANPALFIAMGIFAIVFIVLLLMNIPEPHMVKEVKSKEKSKYSPLSFRHFILGAVAIFVYVGVEVGIPNISNLFMTTKTTEQFAAYEQEYMRQKNDQEYLVQIKAEADKAVAEAEAARVANAPDLKEKVELAKKADSKVISEEEYLKAKEVKIPGLGMDPVTAGSVVGTYWFLMLLGRLVVGASLGARISSKSMLSAASLAGLVFVLLAIFIPTSTTVSMPVFQSDISFGLAQVPISIMFLILCGLCTSIMWGGIFNLAVEGLGKFTAAASGIFMVMVCGGGVLPLIQGGIADSVSYMASFWVIFVGLAYLLFYALIGSKNVNTNIPVE

πŸ“Š Sample Types

Isolate 13.2%
Metagenome 86.8%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Blattidae 27.1%
Termitidae 21.9%
Unclassified 16.7%
Kalotermitidae 14.6%
Rhinotermitidae 5.2%
Formicidae 5.2%
Passalidae 3.1%
Termopsidae 3.1%
Hydrophilidae 2.1%
Hodotermitidae 1.0%

🌳 Taxonomy

Archaea 1
Bacteria 310
Eukaryota 0
Viruses 0
Unclassified 15

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 2225789003 Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) Metagenome Passalidae
2 2830041218 Bacteroides reticulotermitis DSM 105720 Isolate Unclassified
3 2910930387 Dysgonomonas sp. 216 Isolate Blattidae
4 2910942425 Dysgonomonas sp. 521 Isolate Blattidae
5 2940212447 Parabacteroides sp. PH5-16 Isolate Blattidae
6 2940302308 Parabacteroides sp. PF5-5 Isolate Blattidae
7 2940321370 Parabacteroides sp. PH5-39 Isolate Blattidae
8 2940332795 Parabacteroides sp. PH5-8 Isolate Blattidae
9 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
10 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
11 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
12 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
13 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
14 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
15 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
16 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
17 2920168565 Paludibacter sp. 221 Isolate Blattidae
18 2940205530 Parabacteroides sp. PH5-33 Isolate Blattidae
19 2940216256 Dysgonomonadaceae bacterium PH5-43 Isolate Blattidae
20 2940317558 Parabacteroides sp. PH5-26 Isolate Blattidae
21 2940325180 Parabacteroides sp. PH5-41 Isolate Blattidae
22 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
23 2820751898 Unclassified Bacteroidetes Nc150P4bin22 Isolate Unclassified
24 2820757377 Unclassified Bacteroidetes Mp193P4bin6 Isolate Unclassified
25 2873610414 Dysgonomonas sp. HDW5B Isolate Hydrophilidae
26 2940202316 Parabacteroides sp. PF5-9 Isolate Blattidae
27 2940371297 Parabacteroides sp. PM5-20 Isolate Blattidae
28 2967483437 Candidatus Ordinivivax streblomastigis St1 Isolate Unclassified
29 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
30 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
31 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
32 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
33 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
34 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
35 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
36 2940195863 Parabacteroides sp. PF5-6 Isolate Blattidae
37 2940298504 Parabacteroides sp. PF5-13 Isolate Blattidae
38 2940336608 Dysgonomonas sp. PH5-37 Isolate Blattidae
39 3004667792 Bacteroides sp. 519 Isolate Blattidae
40 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
41 3300007129 Ant gut microbial communities from Cephalotes atratus, Brazil Metagenome Formicidae
42 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
43 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
44 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
45 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
46 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
47 2820772500 Unclassified Bacteroidetes Lab288P1bin72 Isolate Unclassified
48 2873600114 Dysgonomonas sp. HDW5A Isolate Hydrophilidae
49 2940193328 Dysgonomonas sp. PH5-45 Isolate Blattidae
50 3004677695 Bacteroides sp. 214 Isolate Blattidae
51 3300007068 Ant gut microbial communities from Cephalotes simillimus, Peru Metagenome Formicidae
52 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
53 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
54 2820746860 Unclassified Bacteroidetes Th196P3bin126 Isolate Unclassified
55 2820759988 Unclassified Bacteroidetes Mp193P4bin4 Isolate Unclassified
56 2910949487 Dysgonomonas sp. 520 Isolate Blattidae
57 2923982719 Parabacteroides sp. 52 Isolate Blattidae
58 2940306115 Parabacteroides sp. PFB2-22 Isolate Blattidae
59 2940309933 Parabacteroides sp. PH5-13 Isolate Blattidae
60 2940328985 Parabacteroides sp. PH5-46 Isolate Blattidae
61 3300007052 Ant gut microbial communities from Cephalotes eduarduli, Brazil Metagenome Formicidae
62 3300007190 Ant gut microbial communities from Cephalotes umbraculatus, Peru Metagenome Formicidae
63 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
64 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
65 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
66 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
67 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
68 8100157865 Dysgonomonas sp. GY617 Isolate Rhinotermitidae
69 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
70 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
71 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
72 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
73 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
74 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
75 2609459943 Bacteroides reticulotermitis JCM 10512 Isolate Rhinotermitidae
76 2695420314 Dysgonomonas sp. BGC7 Isolate Unclassified
77 2820767225 Unclassified Bacteroidetes Lab288P3bin34 Isolate Unclassified
78 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
79 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
80 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
81 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
82 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
83 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
84 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
85 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
86 2695420317 Dysgonomonas sp. HGC4 Isolate Unclassified
87 2820748953 Unclassified Bacteroidetes Nt197P4bin17 Isolate Unclassified
88 2820768849 Unclassified Bacteroidetes Lab288P3bin194 Isolate Unclassified
89 2820774381 Unclassified Bacteroidetes Lab288P1bin37 Isolate Unclassified
90 2922326829 Bacteroides sp. 224 Isolate Blattidae
91 2940313741 Parabacteroides sp. PH5-17 Isolate Blattidae
92 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
93 3300007188 Ant gut microbial communities from Cephalotes rohweri, Arizona, USA Metagenome Formicidae
94 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
95 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
96 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466733_042381 3300042659 Bacteria 10868
2 Ga0466711_047850 3300042615 Bacteria 7357
3 Ga0466711_420180 3300042615 Bacteria 7135
4 Ga0466715_159482 3300042616 Bacteria 5990
5 Ga0466715_181089 3300042616 Bacteria 15777
6 Ga0466723_307687 3300042618 Bacteria 24942
7 Ga0466726_381700 3300042619 Bacteria 15361
8 Ga0466729_028618 3300042621 Bacteria 2494
9 Ga0466690_082186 3300042590 Bacteria 7430
10 Ga0466692_196455 3300042591 Bacteria 23185
11 Ga0466696_286046 3300042596 Bacteria 11686
12 Ga0123353_10177816 3300010167 Bacteria 3372
13 Ga0123354_10226419 3300010882 Bacteria 1969
14 Ga0466700_030199 3300042600 Bacteria 1406
15 Ga0466707_042036 3300042601 Bacteria 5533
16 Ga0466713_043697 3300042602 Bacteria 3590
17 Ga0466713_050637 3300042602 Bacteria 28833
18 Ga0466716_312817 3300042605 Bacteria 2021
19 Ga0466716_425109 3300042605 Bacteria 17659
20 Ga0466735_059574 3300042624 Bacteria 3224
21 Ga0466735_228111 3300042624 Bacteria 1607
22 Ga0466703_084924 3300042636 Bacteria 7752
23 Ga0466704_379629 3300042643 Bacteria 8643
24 Ga0466709_366797 3300042648 Bacteria 2846
25 2226986796 2225789003 Bacteria 1708
26 IMNBL1DRAFT_c0010608 3300000062 Bacteria 4384
27 Ga0068305_10028414 3300005083 Unclassified 6313
28 Ga0123357_10000582 3300009784 Bacteria 36115
29 Ga0466705_131015 3300042612 Bacteria 1852
30 Ga0466705_293761 3300042612 Unclassified 1669
31 Ga0466733_146045 3300042659 Bacteria 46100
32 Ga0466733_218689 3300042659 Bacteria 1769
33 Ga0466715_596959 3300042616 Bacteria 12515
34 Ga0466723_034385 3300042618 Bacteria 31971
35 Ga0466723_105020 3300042618 Bacteria 3811
36 Ga0466657_068251 3300042582 Bacteria 20125
37 Ga0466690_071416 3300042590 Bacteria 9129
38 Ga0466692_068966 3300042591 Bacteria 43940
39 Ga0123357_10010522 3300009784 Bacteria 11774
40 Ga0123356_10026869 3300010049 Bacteria 5398
41 Ga0123356_10113076 3300010049 Bacteria 2626
42 Ga0123356_10244291 3300010049 Bacteria 1868
43 Ga0123353_10026616 3300010167 Bacteria 8841
44 Ga0123354_10205156 3300010882 Bacteria 2152
45 Ga0123354_10215841 3300010882 Bacteria 2056
46 Ga0466706_056869 3300042599 Bacteria 16059
47 Ga0466706_071731 3300042599 Bacteria 3362
48 Ga0466714_053706 3300042603 Bacteria 3203
49 Ga0466698_484167 3300042610 Bacteria 2635
50 Ga0466703_378651 3300042636 Bacteria 11437
51 Ga0466704_002550 3300042643 Bacteria 1796
52 Ga0466709_389355 3300042648 Bacteria 5003
53 Ga0466708_127910 3300042652 Bacteria 13451
54 Ga0466727_057394 3300042655 Bacteria 2465
55 Ga0466727_259057 3300042655 Bacteria 2658
56 2227529891 2225789004 Bacteria 3174
57 JGI24705J35276_12236088 3300002504 Bacteria 7448
58 Ga0103265_1000024 3300007068 Bacteria 23023
59 Ga0466697_165431 3300042611 Bacteria 1442
60 Ga0466733_217448 3300042659 Bacteria 4745
61 Ga0466711_143800 3300042615 Bacteria 6227
62 Ga0466718_034099 3300042617 Bacteria 2607
63 Ga0466726_060357 3300042619 Bacteria 8842
64 Ga0466726_165258 3300042619 Bacteria 1875
65 Ga0466728_073725 3300042620 Bacteria 64638
66 Ga0466728_203310 3300042620 Bacteria 5424
67 Ga0466657_315733 3300042582 Bacteria 6609
68 Ga0466696_248485 3300042596 Unclassified 3291
69 Ga0123357_10010939 3300009784 Bacteria 11585
70 Ga0123356_10133649 3300010049 Bacteria 2435
71 Ga0123353_10028381 3300010167 Bacteria 8597
72 Ga0123354_10132389 3300010882 Bacteria 3141
73 Ga0466701_058955 3300042598 Bacteria 26869
74 Ga0466706_247892 3300042599 Bacteria 15362
75 Ga0466707_085455 3300042601 Bacteria 21640
76 Ga0466707_216378 3300042601 Bacteria 13824
77 Ga0466713_072600 3300042602 Bacteria 14947
78 Ga0466714_087014 3300042603 Bacteria 12878
79 Ga0466719_103504 3300042606 Bacteria 4830
80 Ga0466722_086226 3300042609 Bacteria 13655
81 Ga0466722_175320 3300042609 Bacteria 5187
82 Ga0466722_243095 3300042609 Bacteria 3323
83 Ga0466729_254764 3300042621 Bacteria 8542
84 Ga0466735_126718 3300042624 Bacteria 3088
85 Ga0466704_089145 3300042643 Bacteria 13225
86 Ga0466704_250980 3300042643 Bacteria 4870
87 Ga0466708_148683 3300042652 Bacteria 8019
88 Ga0466708_321468 3300042652 Bacteria 1442
89 Ga0466727_047375 3300042655 Bacteria 1426
90 2227096380 2225789004 Bacteria 1812
91 IMNBL1DRAFT_c0000093 3300000062 Bacteria 77928
92 IMNBL1DRAFT_c0000149 3300000062 Bacteria 62726
93 JGI24702J35022_10002155 3300002462 Bacteria 12143
94 Ga0068305_10052565 3300005083 Bacteria 15214
95 Ga0102734_1000031 3300007129 Bacteria 55117
96 Ga0103264_1000036 3300007188 Bacteria 135516
97 Ga0466733_030153 3300042659 Unclassified 3324
98 Ga0466733_110329 3300042659 Bacteria 2312
99 Ga0466715_115457 3300042616 Bacteria 36939
100 Ga0466715_257264 3300042616 Bacteria 11253
101 Ga0466715_315798 3300042616 Bacteria 3955
102 Ga0466715_444863 3300042616 Bacteria 4531
103 Ga0466723_212262 3300042618 Bacteria 19907
104 Ga0466728_097882 3300042620 Unclassified 2206
105 Ga0466690_078594 3300042590 Bacteria 2371
106 Ga0466692_016417 3300042591 Bacteria 4127
107 Ga0466692_194321 3300042591 Bacteria 22107
108 Ga0466691_047346 3300042593 Bacteria 83606
109 Ga0466696_045091 3300042596 Bacteria 15483
110 Ga0123354_10023133 3300010882 Bacteria 9801
111 Ga0466706_006995 3300042599 Bacteria 7481
112 Ga0466706_134861 3300042599 Bacteria 19873
113 Ga0466714_020370 3300042603 Bacteria 64985
114 Ga0466714_154944 3300042603 Bacteria 103066
115 Ga0466716_339778 3300042605 Bacteria 2054
116 Ga0466719_015535 3300042606 Bacteria 7304
117 Ga0466719_064432 3300042606 Bacteria 10035
118 Ga0466719_120227 3300042606 Bacteria 11923
119 Ga0466719_561741 3300042606 Bacteria 10342
120 Ga0466722_067773 3300042609 Bacteria 4097
121 Ga0466729_300145 3300042621 Bacteria 2477
122 Ga0466735_112855 3300042624 Bacteria 2475
123 Ga0466704_039292 3300042643 Bacteria 5272
124 Ga0466704_078614 3300042643 Bacteria 12503
125 Ga0466704_084952 3300042643 Bacteria 35123
126 Ga0466708_028614 3300042652 Unclassified 4545
127 Ga0466708_033497 3300042652 Bacteria 2183
128 Ga0466727_173858 3300042655 Bacteria 64235
129 JGI24702J35022_10002794 3300002462 Bacteria 10585
130 JGI24699J35502_11134165 3300002509 Bacteria 42441
131 Ga0466705_270858 3300042612 Bacteria 8495
132 Ga0466733_003696 3300042659 Bacteria 1612
133 Ga0466733_047292 3300042659 Bacteria 1670
134 Ga0466733_074294 3300042659 Bacteria 93274
135 Ga0466733_186467 3300042659 Bacteria 27653
136 Ga0466715_157136 3300042616 Bacteria 21139
137 Ga0466715_271419 3300042616 Bacteria 13237
138 Ga0466715_355501 3300042616 Bacteria 4162
139 Ga0466715_400161 3300042616 Bacteria 8851
140 Ga0466715_410857 3300042616 Bacteria 5704
141 Ga0466726_016234 3300042619 Bacteria 5109
142 Ga0466728_107095 3300042620 Bacteria 1671
143 Ga0466690_086675 3300042590 Bacteria 50714
144 Ga0466690_241144 3300042590 Unclassified 5992
145 Ga0466692_188243 3300042591 Bacteria 86416
146 Ga0466691_223368 3300042593 Bacteria 4590
147 Ga0466696_007849 3300042596 Bacteria 54852
148 Ga0466696_158888 3300042596 Bacteria 12492
149 Ga0466696_176991 3300042596 Bacteria 3204
150 Ga0466696_221228 3300042596 Bacteria 3581
151 Ga0466696_322497 3300042596 Bacteria 13119
152 Ga0123356_10036098 3300010049 Bacteria 4616
153 Ga0123353_10000136 3300010167 Bacteria 89026
154 Ga0123353_10381465 3300010167 Bacteria 2108
155 Ga0466706_068424 3300042599 Bacteria 45002
156 Ga0466707_014229 3300042601 Bacteria 20609
157 Ga0466713_002492 3300042602 Bacteria 2032
158 Ga0466713_102671 3300042602 Bacteria 2275
159 Ga0466714_013319 3300042603 Bacteria 54625
160 Ga0466722_251493 3300042609 Bacteria 54791
161 Ga0466735_068503 3300042624 Bacteria 3783
162 Ga0466703_071102 3300042636 Bacteria 7949
163 Ga0466703_075665 3300042636 Bacteria 2617
164 Ga0466703_264650 3300042636 Bacteria 6179
165 Ga0466703_363815 3300042636 Bacteria 9064
166 Ga0466704_140628 3300042643 Bacteria 15835
167 Ga0466704_480030 3300042643 Bacteria 3946
168 Ga0466709_100567 3300042648 Bacteria 1464
169 Ga0466709_304202 3300042648 Bacteria 34829
170 Ga0466709_305666 3300042648 Bacteria 1626
171 Ga0466708_027055 3300042652 Bacteria 23914
172 2227489660 2225789004 Bacteria 4126
173 IMNBL1DRAFT_c0017872 3300000062 Bacteria 2966
174 JGI24699J35502_11134075 3300002509 Bacteria 28429
175 Ga0102736_1000238 3300007052 Unclassified 16121
176 Ga0466733_192441 3300042659 Bacteria 8083
177 Ga0466710_058619 3300042613 Bacteria 5593
178 Ga0466711_168100 3300042615 Bacteria 15409
179 Ga0466711_340964 3300042615 Bacteria 8953
180 Ga0466726_166727 3300042619 Bacteria 1917
181 Ga0466728_065619 3300042620 Bacteria 98744
182 Ga0466728_108137 3300042620 Unclassified 2921
183 Ga0466729_072975 3300042621 Unclassified 5519
184 Ga0466690_007268 3300042590 Bacteria 15926
185 Ga0466690_080367 3300042590 Bacteria 8109
186 Ga0466690_248589 3300042590 Unclassified 2338
187 Ga0466690_350451 3300042590 Bacteria 1652
188 Ga0466690_393883 3300042590 Bacteria 1429
189 Ga0466692_168570 3300042591 Bacteria 17411
190 Ga0123357_10022969 3300009784 Bacteria 8371
191 Ga0123353_10000162 3300010167 Bacteria 85033
192 Ga0123353_10113954 3300010167 Bacteria 4352
193 Ga0123353_10252017 3300010167 Bacteria 2733
194 Ga0123353_10326082 3300010167 Bacteria 2327
195 Ga0123353_10463837 3300010167 Bacteria 1860
196 Ga0123353_10559423 3300010167 Bacteria 1647
197 Ga0466713_123886 3300042602 Bacteria 17149
198 Ga0466716_043422 3300042605 Bacteria 9090
199 Ga0466722_166491 3300042609 Bacteria 6972
200 Ga0466722_266178 3300042609 Bacteria 3291
201 Ga0466729_318175 3300042621 Bacteria 1392
202 Ga0466735_061910 3300042624 Unclassified 2477
203 Ga0466735_091444 3300042624 Bacteria 2924
204 Ga0466703_417492 3300042636 Bacteria 3874
205 Ga0466704_002372 3300042643 Bacteria 57196
206 Ga0466704_045707 3300042643 Bacteria 13124
207 Ga0466709_363785 3300042648 Bacteria 41688
208 Ga0466708_028687 3300042652 Bacteria 5263
209 Ga0466708_221268 3300042652 Bacteria 13982
210 Ga0466708_320806 3300042652 Bacteria 1613
211 Ga0466725_124603 3300042654 Bacteria 11186
212 Ga0466727_189212 3300042655 Bacteria 2579
213 IMNBL1DRAFT_c0002253 3300000062 Bacteria 13587
214 IMNBL1DRAFT_c0028386 3300000062 Bacteria 2088
215 JGI24705J35276_12235290 3300002504 Bacteria 6369
216 Ga0068305_10114351 3300005083 Unclassified 3707
217 Ga0466697_106599 3300042611 Bacteria 91903
218 Ga0466705_275493 3300042612 Bacteria 5076
219 Ga0466733_108515 3300042659 Bacteria 44584
220 Ga0466712_095533 3300042614 Unclassified 2112
221 Ga0466723_046824 3300042618 Bacteria 57163
222 Ga0466726_064395 3300042619 Bacteria 25606
223 Ga0466728_082257 3300042620 Bacteria 106309
224 Ga0466729_085721 3300042621 Bacteria 4355
225 Ga0466656_008367 3300042550 Bacteria 15930
226 Ga0466693_099652 3300042592 Bacteria 4507
227 Ga0466691_113952 3300042593 Bacteria 6351
228 Ga0466691_134901 3300042593 Bacteria 8663
229 Ga0123355_10004769 3300009826 Bacteria 19733
230 Ga0123354_10002011 3300010882 Bacteria 26142
231 Ga0123354_10007441 3300010882 Bacteria 16489
232 Ga0123354_10224573 3300010882 Bacteria 1983
233 Ga0123354_10231461 3300010882 Bacteria 1930
234 Ga0123354_10303003 3300010882 Bacteria 1508
235 Ga0466707_118656 3300042601 Bacteria 4478
236 Ga0466713_112493 3300042602 Bacteria 23866
237 Ga0466714_005444 3300042603 Bacteria 13480
238 Ga0466714_135138 3300042603 Bacteria 3262
239 Ga0466716_263613 3300042605 Bacteria 11222
240 Ga0466722_158513 3300042609 Bacteria 9976
241 Ga0466708_089470 3300042652 Bacteria 12012
242 Ga0466708_210110 3300042652 Bacteria 8557
243 Ga0466727_040552 3300042655 Bacteria 9696
244 2227080826 2225789004 Bacteria 10109
245 2227571856 2225789004 Bacteria 13833
246 JGI24702J35022_10058751 3300002462 Bacteria 2054
247 JGI24705J35276_12220424 3300002504 Archaea 2267
248 JGI24699J35502_11134060 3300002509 Bacteria 27589
249 JGI24699J35502_11134209 3300002509 Bacteria 59622
250 Ga0103267_1000287 3300007190 Bacteria 22317
251 Ga0466697_254053 3300042611 Bacteria 1922
252 Ga0466705_106114 3300042612 Bacteria 1544
253 Ga0466705_117204 3300042612 Bacteria 13174
254 Ga0466733_103970 3300042659 Bacteria 6234
255 Ga0466715_638688 3300042616 Bacteria 40279
256 Ga0466723_186440 3300042618 Bacteria 54567
257 Ga0466726_494144 3300042619 Unclassified 1620
258 Ga0466728_093166 3300042620 Bacteria 80427
259 Ga0466728_399272 3300042620 Bacteria 209367
260 Ga0466657_006320 3300042582 Bacteria 6615
261 Ga0466696_110169 3300042596 Bacteria 19494
262 Ga0466696_237547 3300042596 Bacteria 21193
263 Ga0466696_373365 3300042596 Bacteria 17016
264 Ga0123357_10047865 3300009784 Bacteria 5794
265 Ga0123354_10211914 3300010882 Bacteria 2090
266 Ga0466700_156172 3300042600 Bacteria 109805
267 Ga0466707_069345 3300042601 Bacteria 26773
268 Ga0466707_100948 3300042601 Bacteria 4441
269 Ga0466716_431812 3300042605 Bacteria 8551
270 Ga0466719_041272 3300042606 Bacteria 2247
271 Ga0466719_557299 3300042606 Bacteria 3148
272 Ga0466722_027573 3300042609 Bacteria 5095
273 Ga0466698_317799 3300042610 Bacteria 1588
274 Ga0466729_289649 3300042621 Bacteria 6683
275 Ga0466703_405707 3300042636 Bacteria 7807
276 Ga0466704_045880 3300042643 Bacteria 5575
277 Ga0466704_049264 3300042643 Bacteria 21976
278 Ga0466704_193450 3300042643 Bacteria 17342
279 Ga0466709_003568 3300042648 Bacteria 9102
280 Ga0466709_299886 3300042648 Bacteria 3447
281 Ga0466727_044786 3300042655 Bacteria 8421
282 IMNBL1DRAFT_c0000345 3300000062 Bacteria 39398
283 IMNBL1DRAFT_c0002512 3300000062 Bacteria 12709

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF07690 MFS_1 Major Facilitator Superfamily 328 485 0.81

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.