Protein Family IF07396
Metagenome
Metatranscriptome
Isolate
194
Members
63
Samples
179
Scaffolds
218
Avg Length
Representative Sequence
- ID
- 3300042614|Ga0466712_193735|Ga0466712_193735_534_1112
- Length
- 192 aa
- Sequence
- LKLWGIINFNSETLGIIGVTLRMSLASTFIASILGTVLGLFLERSRFPGKRIAVRLCRTLMGTPPVVAGLVVYLLLMRRGPLGSLGLLFTVEAMVIAQVLIITPIIREMSGEIYFAVITAFSRAISEVGAVMIVGGNIQYRTRTMTTAISMLRNMGDFSQGITLGVLLLLIAFVLQSLSDIVHKGEAPEENL
Sample Types
Isolate
7.7%
Metagenome
91.8%
MAG
0.0%
Metatranscriptome
0.5%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
53.3%
Unclassified
28.3%
Kalotermitidae
10.0%
Rhinotermitidae
5.0%
Termopsidae
3.3%
Taxonomy
Archaea
0
Bacteria
174
Eukaryota
0
Viruses
0
Unclassified
20
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125696 | Treponema sp. Th196P4bin22 | Isolate | Unclassified |
| 2 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 3 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 4 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 5 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 6 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 7 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 8 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 9 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 10 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 11 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 12 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 13 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 14 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 15 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 16 | 2781125630 | Treponema sp. Nt197P3bin60 | Isolate | Unclassified |
| 17 | 2781125657 | Treponema sp. Emb289P3bin15 | Isolate | Unclassified |
| 18 | 2781125697 | Treponema sp. Th196P4bin17 | Isolate | Unclassified |
| 19 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 20 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 21 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 22 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 23 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 24 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 25 | 2781125640 | Treponema sp. Co191P1bin37 | Isolate | Unclassified |
| 26 | 2820439761 | Unclassified Firmicutes Lab288P3bin203 | Isolate | Unclassified |
| 27 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 28 | 2781125652 | Treponema sp. Cu122P5bin1 | Isolate | Unclassified |
| 29 | 2820367663 | Unclassified Firmicutes Nt197P3bin105 | Isolate | Unclassified |
| 30 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 31 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 32 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 33 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 34 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 35 | 2781125656 | Treponema sp. Emb289P1bin65 | Isolate | Unclassified |
| 36 | 2781125665 | Treponema sp. Emb289P3bin117 | Isolate | Unclassified |
| 37 | 2820563109 | Unclassified Firmicutes Emb289P3bin58 | Isolate | Unclassified |
| 38 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 39 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 40 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 41 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 42 | 3300021239 | Termite gut microbial communities from nest from French Guiana - FG16_17_4 mRNA SA | Metatranscriptome | |
| 43 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 44 | 2781125634 | Treponema sp. Co191P1bin45 | Isolate | Unclassified |
| 45 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 46 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 47 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 48 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 49 | 2781125650 | Treponema sp. Co191P3bin64 | Isolate | Unclassified |
| 50 | 2781125651 | Treponema sp. Co191P3bin8 | Isolate | Unclassified |
| 51 | 2820353569 | Unclassified Firmicutes Nt197P3bin28 | Isolate | Unclassified |
| 52 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 53 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 54 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 55 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 56 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 57 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 58 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 59 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 60 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 61 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 62 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 63 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0072941_1039239 | 3300005201 | Bacteria | 17770 |
| 2 | Ga0466732_270756 | 3300042656 | Bacteria | 6624 |
| 3 | Ga0466732_313352 | 3300042656 | Bacteria | 12372 |
| 4 | Ga0415639_020226 | 3300038395 | Bacteria | 5893 |
| 5 | Ga0466692_073514 | 3300042591 | Bacteria | 12002 |
| 6 | Ga0466694_335517 | 3300042594 | Bacteria | 1904 |
| 7 | Ga0466708_022547 | 3300042652 | Bacteria | 24140 |
| 8 | Ga0466701_099568 | 3300042598 | Bacteria | 1196 |
| 9 | Ga0466714_052886 | 3300042603 | Unclassified | 1430 |
| 10 | Ga0466719_394126 | 3300042606 | Bacteria | 1583 |
| 11 | Ga0466721_096679 | 3300042608 | Bacteria | 1457 |
| 12 | Ga0466722_065793 | 3300042609 | Bacteria | 2908 |
| 13 | Ga0466698_076778 | 3300042610 | Bacteria | 1110 |
| 14 | Ga0466697_035136 | 3300042611 | Bacteria | 2780 |
| 15 | Ga0123357_10254614 | 3300009784 | Bacteria | 1870 |
| 16 | Ga0123355_10432315 | 3300009826 | Bacteria | 1673 |
| 17 | Ga0123356_10340417 | 3300010049 | Unclassified | 1620 |
| 18 | Ga0123356_10525121 | 3300010049 | Bacteria | 1342 |
| 19 | Ga0123353_10143362 | 3300010167 | Bacteria | 3824 |
| 20 | JGI24702J35022_10001347 | 3300002462 | Bacteria | 15248 |
| 21 | JGI24702J35022_10010347 | 3300002462 | Unclassified | 5214 |
| 22 | Ga0072941_1002351 | 3300005201 | Bacteria | 15716 |
| 23 | Ga0466732_340999 | 3300042656 | Bacteria | 2306 |
| 24 | Ga0466732_354727 | 3300042656 | Bacteria | 1349 |
| 25 | Ga0415639_038711 | 3300038395 | Bacteria | 2726 |
| 26 | Ga0456237_0007614 | 3300041968 | Unclassified | 1662 |
| 27 | Ga0456237_0020208 | 3300041968 | Unclassified | 923 |
| 28 | Ga0466693_018298 | 3300042592 | Bacteria | 1158 |
| 29 | Ga0466694_084066 | 3300042594 | Bacteria | 1673 |
| 30 | Ga0466694_211575 | 3300042594 | Bacteria | 1145 |
| 31 | Ga0466699_402916 | 3300042597 | Bacteria | 1110 |
| 32 | Ga0466712_041354 | 3300042614 | Bacteria | 6638 |
| 33 | Ga0466712_126251 | 3300042614 | Bacteria | 8183 |
| 34 | Ga0466727_273660 | 3300042655 | Bacteria | 2884 |
| 35 | Ga0466727_330106 | 3300042655 | Unclassified | 1092 |
| 36 | Ga0466700_166223 | 3300042600 | Bacteria | 3261 |
| 37 | Ga0466717_180285 | 3300042604 | Bacteria | 1226 |
| 38 | Ga0466719_005449 | 3300042606 | Bacteria | 6404 |
| 39 | Ga0466720_017711 | 3300042607 | Bacteria | 1007 |
| 40 | Ga0466722_012850 | 3300042609 | Bacteria | 9221 |
| 41 | Ga0123357_10543873 | 3300009784 | Bacteria | 931 |
| 42 | Ga0123355_10144219 | 3300009826 | Unclassified | 3635 |
| 43 | Ga0123356_10000309 | 3300010049 | Bacteria | 55893 |
| 44 | Ga0123356_10677931 | 3300010049 | Bacteria | 1199 |
| 45 | Ga0123353_10315914 | 3300010167 | Bacteria | 2374 |
| 46 | Ga0123353_10686937 | 3300010167 | Bacteria | 1440 |
| 47 | Ga0123353_10718669 | 3300010167 | Bacteria | 1398 |
| 48 | Ga0123353_10902917 | 3300010167 | Bacteria | 1202 |
| 49 | AustNasuHG_c1015967 | 3300000089 | Bacteria | 2522 |
| 50 | AustNasuHG_c1033376 | 3300000089 | Bacteria | 1403 |
| 51 | JGI24702J35022_10046925 | 3300002462 | Bacteria | 2299 |
| 52 | Ga0466656_334431 | 3300042550 | Bacteria | 1288 |
| 53 | Ga0466692_022732 | 3300042591 | Bacteria | 5198 |
| 54 | Ga0466693_156357 | 3300042592 | Bacteria | 3138 |
| 55 | Ga0466693_236414 | 3300042592 | Bacteria | 22577 |
| 56 | Ga0466694_062195 | 3300042594 | Bacteria | 2712 |
| 57 | Ga0466700_116456 | 3300042600 | Bacteria | 1154 |
| 58 | Ga0466700_250499 | 3300042600 | Bacteria | 1051 |
| 59 | Ga0466700_430240 | 3300042600 | Bacteria | 1334 |
| 60 | Ga0466719_043054 | 3300042606 | Bacteria | 3545 |
| 61 | Ga0466721_058905 | 3300042608 | Bacteria | 1331 |
| 62 | Ga0123355_10655900 | 3300009826 | Bacteria | 1223 |
| 63 | Ga0123356_10029185 | 3300010049 | Bacteria | 5168 |
| 64 | Ga0123356_10103026 | 3300010049 | Bacteria | 2741 |
| 65 | Ga0123356_10132171 | 3300010049 | Bacteria | 2447 |
| 66 | Ga0123353_10018813 | 3300010167 | Bacteria | 10234 |
| 67 | Ga0123353_10094012 | 3300010167 | Bacteria | 4831 |
| 68 | Ga0123353_10220261 | 3300010167 | Bacteria | 2968 |
| 69 | Ga0123353_10328815 | 3300010167 | Bacteria | 2315 |
| 70 | Ga0123353_10727494 | 3300010167 | Bacteria | 1386 |
| 71 | JGI24698J34947_10042894 | 3300002449 | Bacteria | 2322 |
| 72 | JGI24695J34938_10009677 | 3300002450 | Bacteria | 5343 |
| 73 | Ga0074263_123989 | 3300005485 | Unclassified | 788 |
| 74 | Ga0223677_1040709 | 3300021239 | Bacteria | 1036 |
| 75 | Ga0264413_135441 | 3300024493 | Bacteria | 1406 |
| 76 | Ga0466692_113311 | 3300042591 | Bacteria | 3020 |
| 77 | Ga0466692_116245 | 3300042591 | Bacteria | 14609 |
| 78 | Ga0466699_051156 | 3300042597 | Bacteria | 2080 |
| 79 | Ga0466718_021305 | 3300042617 | Bacteria | 1926 |
| 80 | Ga0466718_159057 | 3300042617 | Bacteria | 1709 |
| 81 | Ga0466731_122931 | 3300042622 | Bacteria | 1945 |
| 82 | Ga0466714_003295 | 3300042603 | Unclassified | 1226 |
| 83 | Ga0466720_104608 | 3300042607 | Bacteria | 1254 |
| 84 | Ga0123356_10000774 | 3300010049 | Unclassified | 35411 |
| 85 | Ga0123356_10166535 | 3300010049 | Bacteria | 2209 |
| 86 | Ga0123356_10839994 | 3300010049 | Bacteria | 1090 |
| 87 | Ga0123356_11253028 | 3300010049 | Bacteria | 906 |
| 88 | Ga0123353_10314514 | 3300010167 | Bacteria | 2381 |
| 89 | Ga0123353_10622534 | 3300010167 | Bacteria | 1536 |
| 90 | JGI24698J34947_10022128 | 3300002449 | Bacteria | 3411 |
| 91 | Ga0466697_080235 | 3300042611 | Bacteria | 3870 |
| 92 | Ga0466732_059236 | 3300042656 | Bacteria | 1567 |
| 93 | Ga0466699_106283 | 3300042597 | Bacteria | 1937 |
| 94 | Ga0466712_193735 | 3300042614 | Bacteria | 1626 |
| 95 | Ga0466726_314522 | 3300042619 | Bacteria | 1751 |
| 96 | Ga0466724_21017 | 3300042649 | Bacteria | 2014 |
| 97 | Ga0466717_237166 | 3300042604 | Bacteria | 1100 |
| 98 | Ga0123357_10270141 | 3300009784 | Bacteria | 1779 |
| 99 | Ga0123356_10015590 | 3300010049 | Unclassified | 7278 |
| 100 | Ga0123356_10060686 | 3300010049 | Bacteria | 3529 |
| 101 | Ga0123356_10540418 | 3300010049 | Bacteria | 1326 |
| 102 | Ga0123353_10457797 | 3300010167 | Bacteria | 1876 |
| 103 | Ga0123353_10636726 | 3300010167 | Bacteria | 1513 |
| 104 | Ga0123353_10941089 | 3300010167 | Bacteria | 1170 |
| 105 | Ga0123353_10982021 | 3300010167 | Bacteria | 1137 |
| 106 | JGI24698J34947_10001248 | 3300002449 | Bacteria | 13290 |
| 107 | JGI24695J34938_10051146 | 3300002450 | Bacteria | 1810 |
| 108 | JGI24695J34938_10055055 | 3300002450 | Bacteria | 1721 |
| 109 | Ga0466732_442848 | 3300042656 | Bacteria | 1611 |
| 110 | Ga0466733_054759 | 3300042659 | Bacteria | 3625 |
| 111 | Ga0415639_232265 | 3300038395 | Unclassified | 1276 |
| 112 | Ga0466692_154261 | 3300042591 | Bacteria | 2384 |
| 113 | Ga0466694_044991 | 3300042594 | Bacteria | 1948 |
| 114 | Ga0466694_354044 | 3300042594 | Bacteria | 1435 |
| 115 | Ga0466695_363652 | 3300042595 | Bacteria | 4332 |
| 116 | Ga0466718_018043 | 3300042617 | Unclassified | 3515 |
| 117 | Ga0466718_021327 | 3300042617 | Unclassified | 4817 |
| 118 | Ga0466718_116825 | 3300042617 | Bacteria | 11670 |
| 119 | Ga0466725_309432 | 3300042654 | Bacteria | 2835 |
| 120 | Ga0466701_065961 | 3300042598 | Bacteria | 1027 |
| 121 | Ga0466700_083482 | 3300042600 | Bacteria | 2009 |
| 122 | Ga0466714_076527 | 3300042603 | Bacteria | 2273 |
| 123 | Ga0123357_10043003 | 3300009784 | Bacteria | 6139 |
| 124 | Ga0123357_10279996 | 3300009784 | Bacteria | 1725 |
| 125 | Ga0123357_10536010 | 3300009784 | Bacteria | 945 |
| 126 | Ga0123355_10057998 | 3300009826 | Bacteria | 6265 |
| 127 | Ga0123355_10163451 | 3300009826 | Bacteria | 3347 |
| 128 | Ga0123356_10022073 | 3300010049 | Unclassified | 6011 |
| 129 | Ga0123356_10220177 | 3300010049 | Unclassified | 1954 |
| 130 | Ga0123356_11361459 | 3300010049 | Bacteria | 871 |
| 131 | Ga0123353_10013035 | 3300010167 | Bacteria | 11877 |
| 132 | Ga0123353_10307138 | 3300010167 | Bacteria | 2417 |
| 133 | Ga0123353_10985534 | 3300010167 | Bacteria | 1135 |
| 134 | Ga0123354_10631195 | 3300010882 | Bacteria | 773 |
| 135 | JGI24702J35022_10019539 | 3300002462 | Bacteria | 3684 |
| 136 | Ga0068305_10235413 | 3300005083 | Bacteria | 49744 |
| 137 | Ga0466697_192951 | 3300042611 | Bacteria | 2241 |
| 138 | Ga0415639_086388 | 3300038395 | Bacteria | 7713 |
| 139 | Ga0466690_050356 | 3300042590 | Bacteria | 26222 |
| 140 | Ga0466695_207730 | 3300042595 | Bacteria | 1252 |
| 141 | Ga0466711_375111 | 3300042615 | Bacteria | 2370 |
| 142 | Ga0466718_017809 | 3300042617 | Bacteria | 5609 |
| 143 | Ga0466700_308378 | 3300042600 | Bacteria | 8354 |
| 144 | Ga0466707_357801 | 3300042601 | Bacteria | 1238 |
| 145 | Ga0466707_382211 | 3300042601 | Bacteria | 2077 |
| 146 | Ga0466707_394365 | 3300042601 | Bacteria | 4282 |
| 147 | Ga0466714_069567 | 3300042603 | Bacteria | 1625 |
| 148 | Ga0466698_204606 | 3300042610 | Bacteria | 1692 |
| 149 | Ga0123357_10057536 | 3300009784 | Bacteria | 5224 |
| 150 | Ga0123356_10240287 | 3300010049 | Bacteria | 1882 |
| 151 | Ga0123356_10279318 | 3300010049 | Bacteria | 1764 |
| 152 | Ga0123356_10461079 | 3300010049 | Bacteria | 1421 |
| 153 | Ga0123353_10412031 | 3300010167 | Bacteria | 2006 |
| 154 | Ga0123353_10432125 | 3300010167 | Bacteria | 1946 |
| 155 | Ga0123353_10442182 | 3300010167 | Unclassified | 1918 |
| 156 | Ga0123353_10541055 | 3300010167 | Bacteria | 1683 |
| 157 | Ga0123353_10593865 | 3300010167 | Bacteria | 1585 |
| 158 | Ga0123353_10792854 | 3300010167 | Bacteria | 1310 |
| 159 | JGI24698J34947_10099026 | 3300002449 | Unclassified | 1316 |
| 160 | JGI24695J34938_10004227 | 3300002450 | Unclassified | 9536 |
| 161 | JGI24695J34938_10008047 | 3300002450 | Bacteria | 6076 |
| 162 | JGI24695J34938_10090264 | 3300002450 | Bacteria | 1257 |
| 163 | Ga0072941_1035017 | 3300005201 | Bacteria | 7202 |
| 164 | Ga0466692_174943 | 3300042591 | Bacteria | 1089 |
| 165 | Ga0466693_369464 | 3300042592 | Bacteria | 1166 |
| 166 | Ga0466694_198211 | 3300042594 | Unclassified | 1477 |
| 167 | Ga0466695_327807 | 3300042595 | Bacteria | 4581 |
| 168 | Ga0466715_103227 | 3300042616 | Bacteria | 14756 |
| 169 | Ga0466723_140934 | 3300042618 | Bacteria | 4483 |
| 170 | Ga0466731_411472 | 3300042622 | Bacteria | 5447 |
| 171 | Ga0466702_273505 | 3300042635 | Bacteria | 2084 |
| 172 | Ga0466708_128245 | 3300042652 | Bacteria | 2284 |
| 173 | Ga0466717_098883 | 3300042604 | Bacteria | 1963 |
| 174 | Ga0466719_002413 | 3300042606 | Bacteria | 1275 |
| 175 | Ga0123356_10032592 | 3300010049 | Bacteria | 4874 |
| 176 | Ga0123353_10011003 | 3300010167 | Bacteria | 12697 |
| 177 | Ga0123353_11520063 | 3300010167 | Bacteria | 851 |
| 178 | Ga0123354_10140044 | 3300010882 | Bacteria | 2999 |
| 179 | Ga0123354_10183685 | 3300010882 | Bacteria | 2375 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300010167 | Ga0123353_10457797 | Ga0123353_104577972 | 191 |
| 2 | 3300042614 | Ga0466712_193735 | Ga0466712_193735_534_1112 | 192 |
| 3 | 3300002450 | JGI24695J34938_10055055 | JGI24695J34938_100550552 | 195 |
| 4 | 3300042611 | Ga0466697_192951 | Ga0466697_192951_158_829 | 196 |
| 5 | 3300010882 | Ga0123354_10631195 | Ga0123354_106311951 | 202 |
| 6 | 3300038395 | Ga0415639_232265 | Ga0415639_232265_187_858 | 203 |
| 7 | 3300042622 | Ga0466731_411472 | Ga0466731_411472_986_1642 | 203 |
| 8 | 3300010049 | Ga0123356_10220177 | Ga0123356_102201773 | 204 |
| 9 | 3300010049 | Ga0123356_10340417 | Ga0123356_103404172 | 204 |
| 10 | 3300010167 | Ga0123353_10013035 | Ga0123353_100130353 | 204 |
| 11 | 3300041968 | Ga0456237_0020208 | Ga0456237_0020208_295_909 | 204 |
| 12 | 3300042594 | Ga0466694_198211 | Ga0466694_198211_743_1357 | 204 |
| 13 | 3300042594 | Ga0466694_211575 | Ga0466694_211575_78_692 | 204 |
| 14 | 3300042595 | Ga0466695_327807 | Ga0466695_327807_3093_3707 | 204 |
| 15 | 3300042597 | Ga0466699_051156 | Ga0466699_051156_287_901 | 204 |
| 16 | 3300042598 | Ga0466701_065961 | Ga0466701_065961_125_739 | 204 |
| 17 | 3300042600 | Ga0466700_116456 | Ga0466700_116456_431_1045 | 204 |
| 18 | 3300042601 | Ga0466707_382211 | Ga0466707_382211_1425_2039 | 204 |
| 19 | 3300042603 | Ga0466714_069567 | Ga0466714_069567_164_778 | 204 |
| 20 | 3300042604 | Ga0466717_237166 | Ga0466717_237166_23_637 | 204 |
| 21 | 3300042607 | Ga0466720_104608 | Ga0466720_104608_608_1222 | 204 |
| 22 | 3300042610 | Ga0466698_076778 | Ga0466698_076778_147_761 | 204 |
| 23 | 3300042610 | Ga0466698_204606 | Ga0466698_204606_211_825 | 204 |
| 24 | 3300042614 | Ga0466712_041354 | Ga0466712_041354_4259_4873 | 204 |
| 25 | 3300042614 | Ga0466712_126251 | Ga0466712_126251_6476_7090 | 204 |
| 26 | 3300042616 | Ga0466715_103227 | Ga0466715_103227_6278_6892 | 204 |
| 27 | 3300042635 | Ga0466702_273505 | Ga0466702_273505_1148_1762 | 204 |
| 28 | 3300042656 | Ga0466732_059236 | Ga0466732_059236_844_1458 | 204 |
| 29 | 3300002450 | JGI24695J34938_10009677 | JGI24695J34938_100096773 | 205 |
| 30 | 3300009784 | Ga0123357_10270141 | Ga0123357_102701413 | 205 |
| 31 | 3300010049 | Ga0123356_10022073 | Ga0123356_100220735 | 205 |
| 32 | 3300010049 | Ga0123356_10103026 | Ga0123356_101030262 | 205 |
| 33 | 3300010049 | Ga0123356_10132171 | Ga0123356_101321712 | 205 |
| 34 | 3300010049 | Ga0123356_10461079 | Ga0123356_104610792 | 205 |
| 35 | 3300010049 | Ga0123356_10677931 | Ga0123356_106779312 | 205 |
| 36 | 3300010049 | Ga0123356_11253028 | Ga0123356_112530282 | 205 |
| 37 | 3300010049 | Ga0123356_11361459 | Ga0123356_113614591 | 205 |
| 38 | 3300010167 | Ga0123353_10982021 | Ga0123353_109820212 | 205 |
| 39 | 3300042594 | Ga0466694_044991 | Ga0466694_044991_810_1484 | 205 |
| 40 | 3300002450 | JGI24695J34938_10004227 | JGI24695J34938_100042276 | 206 |
| 41 | 3300010049 | Ga0123356_10540418 | Ga0123356_105404181 | 206 |
| 42 | 3300042656 | Ga0466732_354727 | Ga0466732_354727_147_767 | 206 |
| 43 | 3300042594 | Ga0466694_354044 | Ga0466694_354044_94_774 | 207 |
| 44 | 3300042604 | Ga0466717_098883 | Ga0466717_098883_959_1639 | 207 |
| 45 | 3300042656 | Ga0466732_313352 | Ga0466732_313352_6548_7228 | 207 |
| 46 | 3300010167 | Ga0123353_10314514 | Ga0123353_103145142 | 208 |
| 47 | 3300010049 | Ga0123356_10029185 | Ga0123356_100291855 | 209 |
| 48 | 3300010049 | Ga0123356_10060686 | Ga0123356_100606862 | 209 |
| 49 | 3300005201 | Ga0072941_1035017 | Ga0072941_10350172 | 211 |
| 50 | 3300005201 | Ga0072941_1039239 | Ga0072941_103923916 | 211 |
| 51 | 3300009826 | Ga0123355_10057998 | Ga0123355_100579985 | 211 |
| 52 | 3300009826 | Ga0123355_10144219 | Ga0123355_101442192 | 211 |
| 53 | 3300038395 | Ga0415639_020226 | Ga0415639_020226_461_1141 | 211 |
| 54 | 3300002450 | JGI24695J34938_10008047 | JGI24695J34938_100080475 | 212 |
| 55 | 3300042591 | Ga0466692_073514 | Ga0466692_073514_7716_8390 | 212 |
| 56 | 3300042606 | Ga0466719_394126 | Ga0466719_394126_467_1141 | 212 |
| 57 | 3300042617 | Ga0466718_018043 | Ga0466718_018043_1947_2633 | 212 |
| 58 | 3300010049 | Ga0123356_10015590 | Ga0123356_100155907 | 213 |
| 59 | 3300010049 | Ga0123356_10279318 | Ga0123356_102793182 | 213 |
| 60 | 3300010167 | Ga0123353_10018813 | Ga0123353_100188133 | 213 |
| 61 | 3300010167 | Ga0123353_10792854 | Ga0123353_107928542 | 213 |
| 62 | 3300042591 | Ga0466692_154261 | Ga0466692_154261_910_1584 | 213 |
| 63 | 3300042591 | Ga0466692_174943 | Ga0466692_174943_235_909 | 213 |
| 64 | 3300042606 | Ga0466719_002413 | Ga0466719_002413_132_806 | 213 |
| 65 | 3300042617 | Ga0466718_021327 | Ga0466718_021327_1599_2285 | 213 |
| 66 | 3300002450 | JGI24695J34938_10090264 | JGI24695J34938_100902642 | 214 |
| 67 | 3300010049 | Ga0123356_10166535 | Ga0123356_101665352 | 214 |
| 68 | 3300010049 | Ga0123356_10525121 | Ga0123356_105251212 | 214 |
| 69 | 3300010167 | Ga0123353_11520063 | Ga0123353_115200632 | 214 |
| 70 | 3300042595 | Ga0466695_207730 | Ga0466695_207730_69_743 | 215 |
| 71 | 3300042606 | Ga0466719_005449 | Ga0466719_005449_4575_5249 | 215 |
| 72 | 3300042606 | Ga0466719_043054 | Ga0466719_043054_1622_2305 | 216 |
| 73 | 3300009784 | Ga0123357_10536010 | Ga0123357_105360102 | 217 |
| 74 | 3300021239 | Ga0223677_1040709 | Ga0223677_10407091 | 217 |
| 75 | 3300042609 | Ga0466722_012850 | Ga0466722_012850_2054_2734 | 217 |
| 76 | 3300042550 | Ga0466656_334431 | Ga0466656_334431_184_855 | 218 |
| 77 | 3300042592 | Ga0466693_018298 | Ga0466693_018298_259_915 | 218 |
| 78 | 3300042619 | Ga0466726_314522 | Ga0466726_314522_122_796 | 218 |
| 79 | 3300009784 | Ga0123357_10043003 | Ga0123357_100430032 | 219 |
| 80 | 3300010167 | Ga0123353_10442182 | Ga0123353_104421822 | 220 |
| 81 | 3300010882 | Ga0123354_10140044 | Ga0123354_101400444 | 220 |
| 82 | 3300042592 | Ga0466693_369464 | Ga0466693_369464_224_886 | 220 |
| 83 | 3300042598 | Ga0466701_099568 | Ga0466701_099568_343_1005 | 220 |
| 84 | iso_pr_bacteria | 2820439761 | 2820440901 | 220 |
| 85 | 3300042594 | Ga0466694_335517 | Ga0466694_335517_675_1340 | 221 |
| 86 | 3300042601 | Ga0466707_357801 | Ga0466707_357801_278_943 | 221 |
| 87 | 3300042601 | Ga0466707_394365 | Ga0466707_394365_1791_2456 | 221 |
| 88 | 3300042608 | Ga0466721_058905 | Ga0466721_058905_239_904 | 221 |
| 89 | iso_pr_bacteria | 2781125651 | 2781309785 | 221 |
| 90 | iso_pr_bacteria | 2781125697 | 2781443043 | 221 |
| 91 | 3300010167 | Ga0123353_10432125 | Ga0123353_104321252 | 222 |
| 92 | 3300042600 | Ga0466700_308378 | Ga0466700_308378_6958_7626 | 222 |
| 93 | 3300002462 | JGI24702J35022_10001347 | JGI24702J35022_1000134713 | 223 |
| 94 | 3300005201 | Ga0072941_1002351 | Ga0072941_100235113 | 223 |
| 95 | 3300010167 | Ga0123353_10412031 | Ga0123353_104120313 | 223 |
| 96 | 3300038395 | Ga0415639_086388 | Ga0415639_086388_968_1639 | 223 |
| 97 | 3300042600 | Ga0466700_250499 | Ga0466700_250499_275_946 | 223 |
| 98 | 3300042603 | Ga0466714_003295 | Ga0466714_003295_206_877 | 223 |
| 99 | 3300042603 | Ga0466714_052886 | Ga0466714_052886_553_1224 | 223 |
| 100 | 3300042603 | Ga0466714_076527 | Ga0466714_076527_202_873 | 223 |
| 101 | 3300042617 | Ga0466718_021305 | Ga0466718_021305_879_1550 | 223 |
| 102 | 3300042659 | Ga0466733_054759 | Ga0466733_054759_191_862 | 223 |
| 103 | iso_pr_bacteria | 2781125652 | 2781312661 | 223 |
| 104 | iso_pr_bacteria | 2820353569 | 2820355405 | 223 |
| 105 | iso_pr_bacteria | 2820563109 | 2820564647 | 223 |
| 106 | 3300009784 | Ga0123357_10057536 | Ga0123357_100575365 | 224 |
| 107 | 3300009784 | Ga0123357_10254614 | Ga0123357_102546142 | 224 |
| 108 | 3300009784 | Ga0123357_10279996 | Ga0123357_102799962 | 224 |
| 109 | 3300009826 | Ga0123355_10163451 | Ga0123355_101634512 | 224 |
| 110 | 3300009826 | Ga0123355_10432315 | Ga0123355_104323152 | 224 |
| 111 | 3300009826 | Ga0123355_10655900 | Ga0123355_106559002 | 224 |
| 112 | 3300010049 | Ga0123356_10000774 | Ga0123356_1000077416 | 224 |
| 113 | 3300010049 | Ga0123356_10839994 | Ga0123356_108399941 | 224 |
| 114 | 3300010167 | Ga0123353_10011003 | Ga0123353_1001100317 | 224 |
| 115 | 3300010167 | Ga0123353_10143362 | Ga0123353_101433623 | 224 |
| 116 | 3300010167 | Ga0123353_10220261 | Ga0123353_102202612 | 224 |
| 117 | 3300010167 | Ga0123353_10315914 | Ga0123353_103159141 | 224 |
| 118 | 3300010167 | Ga0123353_10541055 | Ga0123353_105410552 | 224 |
| 119 | 3300010167 | Ga0123353_10593865 | Ga0123353_105938652 | 224 |
| 120 | 3300010167 | Ga0123353_10686937 | Ga0123353_106869372 | 224 |
| 121 | 3300010167 | Ga0123353_10718669 | Ga0123353_107186691 | 224 |
| 122 | 3300010167 | Ga0123353_10985534 | Ga0123353_109855342 | 224 |
| 123 | 3300010882 | Ga0123354_10183685 | Ga0123354_101836852 | 224 |
| 124 | 3300041968 | Ga0456237_0007614 | Ga0456237_0007614_429_1103 | 224 |
| 125 | 3300042590 | Ga0466690_050356 | Ga0466690_050356_2309_2983 | 224 |
| 126 | 3300042591 | Ga0466692_022732 | Ga0466692_022732_4088_4762 | 224 |
| 127 | 3300042591 | Ga0466692_113311 | Ga0466692_113311_542_1216 | 224 |
| 128 | 3300042591 | Ga0466692_116245 | Ga0466692_116245_1356_2030 | 224 |
| 129 | 3300042592 | Ga0466693_156357 | Ga0466693_156357_1058_1732 | 224 |
| 130 | 3300042594 | Ga0466694_084066 | Ga0466694_084066_299_973 | 224 |
| 131 | 3300042595 | Ga0466695_363652 | Ga0466695_363652_1154_1828 | 224 |
| 132 | 3300042600 | Ga0466700_083482 | Ga0466700_083482_1046_1720 | 224 |
| 133 | 3300042600 | Ga0466700_166223 | Ga0466700_166223_472_1146 | 224 |
| 134 | 3300042604 | Ga0466717_180285 | Ga0466717_180285_360_1034 | 224 |
| 135 | 3300042609 | Ga0466722_065793 | Ga0466722_065793_1228_1902 | 224 |
| 136 | 3300042611 | Ga0466697_080235 | Ga0466697_080235_324_998 | 224 |
| 137 | 3300042618 | Ga0466723_140934 | Ga0466723_140934_2600_3274 | 224 |
| 138 | 3300042622 | Ga0466731_122931 | Ga0466731_122931_718_1392 | 224 |
| 139 | 3300042654 | Ga0466725_309432 | Ga0466725_309432_366_1040 | 224 |
| 140 | 3300042656 | Ga0466732_270756 | Ga0466732_270756_4027_4701 | 224 |
| 141 | iso_pr_bacteria | 2781125640 | 2781288870 | 224 |
| 142 | iso_pr_bacteria | 2781125696 | 2781440893 | 224 |
| 143 | 3300002449 | JGI24698J34947_10022128 | JGI24698J34947_100221285 | 225 |
| 144 | 3300002450 | JGI24695J34938_10051146 | JGI24695J34938_100511462 | 225 |
| 145 | 3300002462 | JGI24702J35022_10010347 | JGI24702J35022_100103474 | 225 |
| 146 | 3300010049 | Ga0123356_10032592 | Ga0123356_100325924 | 225 |
| 147 | 3300010049 | Ga0123356_10240287 | Ga0123356_102402872 | 225 |
| 148 | 3300010167 | Ga0123353_10328815 | Ga0123353_103288153 | 225 |
| 149 | 3300010167 | Ga0123353_10622534 | Ga0123353_106225343 | 225 |
| 150 | 3300010167 | Ga0123353_10902917 | Ga0123353_109029172 | 225 |
| 151 | 3300010167 | Ga0123353_10941089 | Ga0123353_109410892 | 225 |
| 152 | 3300042594 | Ga0466694_062195 | Ga0466694_062195_1289_1966 | 225 |
| 153 | 3300042608 | Ga0466721_096679 | Ga0466721_096679_464_1141 | 225 |
| 154 | iso_pr_bacteria | 2781125634 | 2781275367 | 225 |
| 155 | iso_pr_bacteria | 2781125650 | 2781308428 | 225 |
| 156 | iso_pr_bacteria | 2781125657 | 2781324493 | 225 |
| 157 | iso_pr_bacteria | 2781125665 | 2781341435 | 225 |
| 158 | 3300005083 | Ga0068305_10235413 | Ga0068305_102354137 | 226 |
| 159 | 3300010049 | Ga0123356_10000309 | Ga0123356_1000030916 | 226 |
| 160 | 3300024493 | Ga0264413_135441 | Ga0264413_1354412 | 226 |
| 161 | 3300038395 | Ga0415639_038711 | Ga0415639_038711_1771_2451 | 226 |
| 162 | 3300042592 | Ga0466693_236414 | Ga0466693_236414_15565_16245 | 226 |
| 163 | 3300042607 | Ga0466720_017711 | Ga0466720_017711_88_768 | 226 |
| 164 | 3300042656 | Ga0466732_340999 | Ga0466732_340999_1055_1735 | 226 |
| 165 | 3300042656 | Ga0466732_442848 | Ga0466732_442848_323_1003 | 226 |
| 166 | iso_pr_bacteria | 2781125630 | 2781267226 | 226 |
| 167 | iso_pr_bacteria | 2781125656 | 2781319759 | 226 |
| 168 | 3300000089 | AustNasuHG_c1033376 | AustNasuHG_10333762 | 227 |
| 169 | 3300002449 | JGI24698J34947_10001248 | JGI24698J34947_100012483 | 227 |
| 170 | 3300002449 | JGI24698J34947_10042894 | JGI24698J34947_100428942 | 227 |
| 171 | 3300002449 | JGI24698J34947_10099026 | JGI24698J34947_100990261 | 227 |
| 172 | 3300002462 | JGI24702J35022_10019539 | JGI24702J35022_100195394 | 227 |
| 173 | 3300002462 | JGI24702J35022_10046925 | JGI24702J35022_100469251 | 227 |
| 174 | 3300005485 | Ga0074263_123989 | Ga0074263_1239891 | 227 |
| 175 | 3300010167 | Ga0123353_10094012 | Ga0123353_100940124 | 227 |
| 176 | 3300010167 | Ga0123353_10727494 | Ga0123353_107274942 | 227 |
| 177 | 3300042611 | Ga0466697_035136 | Ga0466697_035136_1051_1734 | 227 |
| 178 | 3300042615 | Ga0466711_375111 | Ga0466711_375111_750_1433 | 227 |
| 179 | 3300042617 | Ga0466718_159057 | Ga0466718_159057_187_870 | 227 |
| 180 | 3300042652 | Ga0466708_022547 | Ga0466708_022547_7581_8264 | 227 |
| 181 | 3300000089 | AustNasuHG_c1015967 | AustNasuHG_10159672 | 228 |
| 182 | 3300010167 | Ga0123353_10307138 | Ga0123353_103071383 | 228 |
| 183 | 3300042600 | Ga0466700_430240 | Ga0466700_430240_559_1245 | 228 |
| 184 | 3300042617 | Ga0466718_017809 | Ga0466718_017809_4029_4715 | 228 |
| 185 | 3300042617 | Ga0466718_116825 | Ga0466718_116825_9344_10030 | 228 |
| 186 | 3300042649 | Ga0466724_21017 | Ga0466724_21017_508_1194 | 228 |
| 187 | 3300009784 | Ga0123357_10543873 | Ga0123357_105438732 | 229 |
| 188 | 3300010167 | Ga0123353_10636726 | Ga0123353_106367262 | 230 |
| 189 | 3300042597 | Ga0466699_106283 | Ga0466699_106283_86_778 | 230 |
| 190 | 3300042597 | Ga0466699_402916 | Ga0466699_402916_134_826 | 230 |
| 191 | iso_pr_bacteria | 2820367663 | 2820368241 | 231 |
| 192 | 3300042655 | Ga0466727_330106 | Ga0466727_330106_30_767 | 236 |
| 193 | 3300042655 | Ga0466727_273660 | Ga0466727_273660_1036_1749 | 237 |
| 194 | 3300042652 | Ga0466708_128245 | Ga0466708_128245_1357_2076 | 239 |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.84 | 0.89 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.