Protein Family IF07357

Metagenome Isolate
137 Members
53 Samples
123 Scaffolds
251.16 Avg Length

🧬 Representative Sequence

ID
3300042614|Ga0466712_071926|Ga0466712_071926_6526_7347
Length
273 aa
Sequence
LGDALRGKQEIFRLLRTAKKDVMNKQETLEILRKIQIGEISPEDALMKLCTEPFEDLGYAKLDNHRELRQGIPEVIYGAGKTPEQITGIASAMRNKGQRLILITRLAQDIAASVKESLPLQYHETARIGIIGDIPESDGIGKIVVATGGTSDMPVAEEAALTAEALGNSVVRLYDVGVAGLHRLLSRLKDIMDAQVIIAIAGMEGALASVIGGLVDCPVIGVPTSVGYGASFNGLSALLAMLNSCASGVSVVNIDNGFGAGYLASMINHQRYK

📊 Sample Types

Isolate 10.2%
Metagenome 89.8%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 52.0%
Unclassified 30.0%
Kalotermitidae 8.0%
Tenebrionidae 2.0%
Passalidae 2.0%
Rhinotermitidae 2.0%
Termopsidae 2.0%
Hodotermitidae 2.0%

🌳 Taxonomy

Archaea 0
Bacteria 121
Eukaryota 0
Viruses 0
Unclassified 16

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 8030347546 Propionimicrobium sp. PCR01-08-3 Isolate Tenebrionidae
2 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
3 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
4 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
5 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
6 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
7 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
8 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
9 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
10 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
11 2820671341 Unclassified Firmicutes Co191P3bin20 Isolate Unclassified
12 2820946191 Unclassified Acidobacteria Nt197P3bin31 Isolate Unclassified
13 2820848511 Unclassified Actinobacteria Lab288P3bin86 Isolate Unclassified
14 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
15 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
16 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
17 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
18 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
19 2778260940 Unclassified Fibrobacteres Mp193P3bin36 Isolate Unclassified
20 2819990093 Unclassified Spirochaetes Cu122P1bin9 Isolate Unclassified
21 2820261600 Unclassified Firmicutes Th196P3bin40 Isolate Unclassified
22 2820424542 Unclassified Firmicutes Lab288P3bin47 Isolate Unclassified
23 3300005485 Termite gut microbial communities from Costa Rica - P3 luminal contents Metagenome Termitidae
24 2820242869 Unclassified Firmicutes Th196P3bin82 Isolate Unclassified
25 2820348946 Unclassified Firmicutes Nt197P3bin47 Isolate Unclassified
26 2820512088 Unclassified Firmicutes Lab288P1bin4 Isolate Unclassified
27 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
28 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
29 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
30 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
31 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
32 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
33 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
34 2820021908 Unclassified Spirochaetes Lab288P4bin6 Isolate Unclassified
35 2820587002 Unclassified Firmicutes Emb289P1bin94 Isolate Unclassified
36 2820947865 Unclassified Acidobacteria Nt197P3bin133 Isolate Unclassified
37 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
38 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
39 3300002501 Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 Metagenome Termitidae
40 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
41 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
42 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
43 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
44 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
45 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
46 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
47 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
48 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
49 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
50 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
51 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
52 3300001880 Termite hindgut microbial communities from the Max Planck Institute, Bremen, Germany, analyzing fibers in the hindgut lumen - ASSEMBLED Fiber-Associated Metagenome Metagenome
53 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466733_055717 3300042659 Bacteria 7069
2 Ga0466720_032189 3300042607 Bacteria 77627
3 Ga0466720_187200 3300042607 Bacteria 2635
4 JGI24698J34947_10002009 3300002449 Bacteria 10837
5 JGI24698J34947_10041438 3300002449 Bacteria 2372
6 Ga0072940_1002172 3300005200 Unclassified 3462
7 Ga0072941_1031481 3300005201 Bacteria 8850
8 Ga0264413_106825 3300024493 Bacteria 9881
9 Ga0264413_114912 3300024493 Bacteria 10558
10 Ga0415639_007788 3300038395 Bacteria 18207
11 Ga0123355_10006913 3300009826 Bacteria 16894
12 Ga0123355_10087180 3300009826 Unclassified 4962
13 Ga0123356_11242549 3300010049 Bacteria 910
14 Ga0123353_10000033 3300010167 Bacteria 150421
15 Ga0466720_073942 3300042607 Bacteria 41900
16 JGI24698J34947_10000028 3300002449 Bacteria 39224
17 Ga0264413_111176 3300024493 Bacteria 6387
18 Ga0264413_132854 3300024493 Unclassified 1727
19 Ga0415639_004686 3300038395 Bacteria 55715
20 Ga0466696_323732 3300042596 Bacteria 1081
21 Ga0466699_164653 3300042597 Bacteria 1924
22 Ga0123355_10056122 3300009826 Unclassified 6375
23 Ga0123355_10092202 3300009826 Bacteria 4800
24 Ga0123355_10103773 3300009826 Bacteria 4467
25 Ga0123355_10202721 3300009826 Bacteria 2893
26 Ga0123353_10118906 3300010167 Bacteria 4250
27 Ga0466702_016292 3300042635 Bacteria 1524
28 Ga0466725_296355 3300042654 Bacteria 4268
29 Ga0466712_037773 3300042614 Unclassified 3104
30 Ga0466712_304807 3300042614 Unclassified 2040
31 Ga0466718_015399 3300042617 Bacteria 1794
32 Ga0466706_179712 3300042599 Bacteria 27060
33 Ga0466720_120684 3300042607 Bacteria 46600
34 Ga0466698_047830 3300042610 Bacteria 2120
35 IMNBL1DRAFT_c0001128 3300000062 Bacteria 20470
36 FAAS_10006995 3300001880 Bacteria 1053
37 JGI24698J34947_10025569 3300002449 Bacteria 3142
38 Ga0072941_1008877 3300005201 Bacteria 19516
39 Ga0072941_1108493 3300005201 Bacteria 4412
40 Ga0466699_314904 3300042597 Bacteria 1336
41 Ga0123355_10004516 3300009826 Bacteria 20241
42 Ga0123355_10709119 3300009826 Unclassified 1152
43 Ga0123353_10711663 3300010167 Unclassified 1407
44 Ga0466718_022527 3300042617 Bacteria 15487
45 Ga0466718_032476 3300042617 Bacteria 9536
46 Ga0466729_116407 3300042621 Bacteria 45416
47 Ga0466700_375681 3300042600 Bacteria 1311
48 Ga0466719_238384 3300042606 Bacteria 11408
49 Ga0466721_124294 3300042608 Bacteria 4331
50 JGI24698J34947_10002462 3300002449 Unclassified 9987
51 JGI24703J35330_11650465 3300002501 Unclassified 1595
52 Ga0264413_136540 3300024493 Bacteria 2021
53 Ga0466694_053604 3300042594 Unclassified 6968
54 Ga0466694_144342 3300042594 Bacteria 1144
55 Ga0466699_116244 3300042597 Bacteria 1884
56 Ga0123355_10067871 3300009826 Bacteria 5738
57 Ga0123356_10420906 3300010049 Bacteria 1478
58 Ga0123353_10021763 3300010167 Bacteria 9636
59 Ga0123354_10031416 3300010882 Bacteria 8330
60 Ga0466712_071926 3300042614 Bacteria 12700
61 Ga0466715_302798 3300042616 Bacteria 11047
62 Ga0466728_365737 3300042620 Bacteria 2871
63 Ga0466732_341296 3300042656 Bacteria 5872
64 Ga0466707_089948 3300042601 Bacteria 3580
65 JGI24698J34947_10028407 3300002449 Bacteria 2961
66 JGI24698J34947_10041069 3300002449 Unclassified 2384
67 Ga0072941_1000674 3300005201 Bacteria 56929
68 Ga0074263_117996 3300005485 Unclassified 1592
69 Ga0466699_278674 3300042597 Unclassified 2453
70 Ga0123355_10009379 3300009826 Bacteria 14861
71 Ga0123356_10411536 3300010049 Bacteria 1492
72 Ga0123353_10328106 3300010167 Unclassified 2318
73 Ga0466731_066645 3300042622 Bacteria 19364
74 Ga0466712_091914 3300042614 Bacteria 2831
75 Ga0466712_197155 3300042614 Bacteria 15501
76 Ga0466712_235535 3300042614 Bacteria 4470
77 Ga0466700_215848 3300042600 Bacteria 1885
78 Ga0466714_027676 3300042603 Bacteria 14451
79 Ga0466714_058513 3300042603 Bacteria 20042
80 Ga0466721_189622 3300042608 Bacteria 35753
81 JGI24698J34947_10000413 3300002449 Bacteria 19568
82 Ga0072941_1003034 3300005201 Bacteria 52020
83 Ga0074263_115660 3300005485 Bacteria 2527
84 Ga0415639_047637 3300038395 Bacteria 3852
85 Ga0415639_192146 3300038395 Bacteria 2252
86 Ga0466699_380114 3300042597 Bacteria 1013
87 Ga0123355_10000891 3300009826 Bacteria 41353
88 Ga0123356_10858031 3300010049 Bacteria 1079
89 Ga0466712_029529 3300042614 Bacteria 3497
90 Ga0466712_036251 3300042614 Bacteria 44742
91 Ga0466712_182170 3300042614 Bacteria 3514
92 Ga0466714_108034 3300042603 Bacteria 3191
93 AustNasuHG_c1022192 3300000089 Bacteria 2043
94 JGI24698J34947_10005838 3300002449 Bacteria 6747
95 JGI24698J34947_10027921 3300002449 Bacteria 2993
96 JGI24695J34938_10011935 3300002450 Bacteria 4638
97 Ga0068305_10023251 3300005083 Bacteria 105200
98 Ga0466694_003877 3300042594 Bacteria 5883
99 Ga0466699_242525 3300042597 Bacteria 1012
100 Ga0123355_10042169 3300009826 Bacteria 7427
101 Ga0123355_10063498 3300009826 Bacteria 5955
102 Ga0123355_10105195 3300009826 Bacteria 4429
103 Ga0123356_10331398 3300010049 Bacteria 1639
104 Ga0123354_10091137 3300010882 Bacteria 4214
105 Ga0466712_008043 3300042614 Bacteria 12868
106 Ga0466726_183498 3300042619 Bacteria 22098
107 Ga0466714_163683 3300042603 Bacteria 7121
108 JGI24698J34947_10002652 3300002449 Bacteria 9640
109 JGI24698J34947_10015471 3300002449 Bacteria 4152
110 JGI24698J34947_10046777 3300002449 Bacteria 2199
111 JGI24695J34938_10005289 3300002450 Bacteria 8106
112 Ga0072940_1011141 3300005200 Bacteria 2979
113 Ga0072941_1013401 3300005201 Bacteria 13460
114 Ga0072941_1192944 3300005201 Bacteria 2753
115 Ga0072941_1406454 3300005201 Bacteria 7564
116 Ga0264413_108156 3300024493 Bacteria 25571
117 Ga0264413_115174 3300024493 Unclassified 3264
118 Ga0123355_10001021 3300009826 Bacteria 38874
119 Ga0123353_10003750 3300010167 Bacteria 19342
120 Ga0123353_10127828 3300010167 Bacteria 4081
121 Ga0466710_017182 3300042613 Bacteria 1019
122 Ga0466718_028625 3300042617 Bacteria 5143
123 Ga0466718_092732 3300042617 Bacteria 3550

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00731 AIRC AIR carboxylase 142 267 0.87

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF00731 GO:0006189 'de novo' IMP biosynthetic process BP

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.