Protein Family IF07263
Metagenome
Isolate
435
Members
110
Samples
381
Scaffolds
342.84
Avg Length
Representative Sequence
- ID
- 3300042612|Ga0466705_527363|Ga0466705_527363_6706_7917
- Length
- 403 aa
- Sequence
- MYARQSQSVQNGTEKTEPAFLKQSKIYDWNLIQNGCNSELIWNVPVFHVNLHLLNKKNLMKRKVLVTGGAGYIGSHTTVELQNAGYDVVIVDNLSNSNANVIDGIEKISGVRPAFEKVDCTEKEALQKVFDTYPGINGIIHFAASKAVGESVHLPLLYYRNNLVSLINLLELMPVYNVDGIVFSSSCTVYGQPEVLPVTESAPIQPALSPYGNSKQINEEIIRDAIHSGVSYKSIILRYFNPIGAHPSAEIGELPNGVPQNLIPFLTQTAIGIRKELSVYGNDYNTPDGSCIRDYINVVDLSRAHVVAIKRMLENKSGAQLEYFNLGTGKGLSVLELINAFEKATGVKVPHKITGRREGDIEQIWADPRYANEVLGWKTVETIEDTLRSSWKWQLKLRERGIM
Sample Types
Isolate
12.4%
Metagenome
87.6%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Blattidae
32.1%
Termitidae
23.9%
Kalotermitidae
12.8%
Unclassified
11.9%
Rhinotermitidae
5.5%
Termopsidae
3.7%
Apidae
2.8%
Passalidae
2.8%
Hydrophilidae
1.8%
Hodotermitidae
0.9%
Tenebrionidae
0.9%
Elmidae
0.9%
Taxonomy
Archaea
1
Bacteria
416
Eukaryota
0
Viruses
0
Unclassified
18
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820757377 | Unclassified Bacteroidetes Mp193P4bin6 | Isolate | Unclassified |
| 2 | 2873610414 | Dysgonomonas sp. HDW5B | Isolate | Hydrophilidae |
| 3 | 2940199050 | Parabacteroides sp. PM6-13 | Isolate | Blattidae |
| 4 | 2940202316 | Parabacteroides sp. PF5-9 | Isolate | Blattidae |
| 5 | 2940371297 | Parabacteroides sp. PM5-20 | Isolate | Blattidae |
| 6 | 2967483437 | Candidatus Ordinivivax streblomastigis St1 | Isolate | Unclassified |
| 7 | 3300000333 | Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony | Metagenome | Apidae |
| 8 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 9 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 10 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 11 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 12 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 13 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 14 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 15 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 16 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 17 | 2820759988 | Unclassified Bacteroidetes Mp193P4bin4 | Isolate | Unclassified |
| 18 | 2910949487 | Dysgonomonas sp. 520 | Isolate | Blattidae |
| 19 | 2910959314 | Dysgonomonas sp. 511 | Isolate | Blattidae |
| 20 | 2923982719 | Parabacteroides sp. 52 | Isolate | Blattidae |
| 21 | 2940306115 | Parabacteroides sp. PFB2-22 | Isolate | Blattidae |
| 22 | 2940309933 | Parabacteroides sp. PH5-13 | Isolate | Blattidae |
| 23 | 2940328985 | Parabacteroides sp. PH5-46 | Isolate | Blattidae |
| 24 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 25 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 26 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 27 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 28 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 29 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 30 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 31 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 32 | 8100157865 | Dysgonomonas sp. GY617 | Isolate | Rhinotermitidae |
| 33 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 34 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 35 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 36 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 37 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 38 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 39 | 2799112231 | Apibacter sp. ESL0432 | Isolate | Unclassified |
| 40 | 2910926975 | Dysgonomonas sp. 25 | Isolate | Blattidae |
| 41 | 2940195863 | Parabacteroides sp. PF5-6 | Isolate | Blattidae |
| 42 | 2940209341 | Parabacteroides sp. PFB2-10 | Isolate | Blattidae |
| 43 | 2940298504 | Parabacteroides sp. PF5-13 | Isolate | Blattidae |
| 44 | 2940336608 | Dysgonomonas sp. PH5-37 | Isolate | Blattidae |
| 45 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 46 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 47 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 48 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 49 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 50 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 51 | 2695420314 | Dysgonomonas sp. BGC7 | Isolate | Unclassified |
| 52 | 2785510743 | Apibacter sp. ESL0404 | Isolate | Apidae |
| 53 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 54 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 55 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 56 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 57 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 58 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 59 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 60 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 61 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 62 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 63 | 2695420317 | Dysgonomonas sp. HGC4 | Isolate | Unclassified |
| 64 | 2922326829 | Bacteroides sp. 224 | Isolate | Blattidae |
| 65 | 2940253009 | Dysgonomonas sp. PF1-23 | Isolate | Blattidae |
| 66 | 2940257232 | Dysgonomonas sp. PFB1-18 | Isolate | Blattidae |
| 67 | 2940313741 | Parabacteroides sp. PH5-17 | Isolate | Blattidae |
| 68 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 69 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 70 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 71 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 72 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 73 | 2225789003 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) | Metagenome | Passalidae |
| 74 | 2830041218 | Bacteroides reticulotermitis DSM 105720 | Isolate | Unclassified |
| 75 | 2832298047 | Apibacter sp. wkB309 | Isolate | Apidae |
| 76 | 2910930387 | Dysgonomonas sp. 216 | Isolate | Blattidae |
| 77 | 2910942425 | Dysgonomonas sp. 521 | Isolate | Blattidae |
| 78 | 2940212447 | Parabacteroides sp. PH5-16 | Isolate | Blattidae |
| 79 | 2940244548 | Dysgonomonas sp. PF1-14 | Isolate | Blattidae |
| 80 | 2940302308 | Parabacteroides sp. PF5-5 | Isolate | Blattidae |
| 81 | 2940321370 | Parabacteroides sp. PH5-39 | Isolate | Blattidae |
| 82 | 2940332795 | Parabacteroides sp. PH5-8 | Isolate | Blattidae |
| 83 | 3004672520 | Bacteroides sp. 51 | Isolate | Blattidae |
| 84 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 85 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 86 | 643348524 | Candidatus Azobacteroides pseudotrichonymphae gv. CFP2 | Isolate | Unclassified |
| 87 | 8100166142 | Dysgonomonas sp. GY75 | Isolate | Rhinotermitidae |
| 88 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 89 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 90 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 91 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 92 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 93 | 2873600114 | Dysgonomonas sp. HDW5A | Isolate | Hydrophilidae |
| 94 | 2940193328 | Dysgonomonas sp. PH5-45 | Isolate | Blattidae |
| 95 | 2940248789 | Dysgonomonas sp. PF1-16 | Isolate | Blattidae |
| 96 | 2940346213 | Parabacteroides sp. PFB2-12 | Isolate | Blattidae |
| 97 | 3004677695 | Bacteroides sp. 214 | Isolate | Blattidae |
| 98 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 99 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 100 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 101 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 102 | 2695420931 | Dysgonomonas macrotermitis DSM 27370 | Isolate | Unclassified |
| 103 | 2820762746 | Unclassified Bacteroidetes Mp193P4bin3 | Isolate | Unclassified |
| 104 | 2864836148 | Arcicella rosea S00070 | Isolate | Elmidae |
| 105 | 2920168565 | Paludibacter sp. 221 | Isolate | Blattidae |
| 106 | 2940205530 | Parabacteroides sp. PH5-33 | Isolate | Blattidae |
| 107 | 2940216256 | Dysgonomonadaceae bacterium PH5-43 | Isolate | Blattidae |
| 108 | 2940317558 | Parabacteroides sp. PH5-26 | Isolate | Blattidae |
| 109 | 2940325180 | Parabacteroides sp. PH5-41 | Isolate | Blattidae |
| 110 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_077431 | 3300042612 | Bacteria | 39083 |
| 2 | Ga0123353_10170336 | 3300010167 | Bacteria | 3457 |
| 3 | Ga0466706_097450 | 3300042599 | Bacteria | 22180 |
| 4 | Ga0466706_172353 | 3300042599 | Bacteria | 1982 |
| 5 | Ga0466713_084165 | 3300042602 | Bacteria | 2476 |
| 6 | Ga0466713_130958 | 3300042602 | Bacteria | 9589 |
| 7 | Ga0466713_147689 | 3300042602 | Bacteria | 31697 |
| 8 | Ga0466713_148662 | 3300042602 | Bacteria | 25209 |
| 9 | Ga0466716_283586 | 3300042605 | Bacteria | 36250 |
| 10 | Ga0466716_371651 | 3300042605 | Bacteria | 1451 |
| 11 | Ga0466716_385656 | 3300042605 | Bacteria | 1355 |
| 12 | Ga0466716_435653 | 3300042605 | Bacteria | 6416 |
| 13 | Ga0466719_117183 | 3300042606 | Bacteria | 13535 |
| 14 | Ga0466711_020216 | 3300042615 | Bacteria | 9627 |
| 15 | Ga0466711_025752 | 3300042615 | Bacteria | 2025 |
| 16 | Ga0466711_031794 | 3300042615 | Bacteria | 3257 |
| 17 | Ga0466711_238407 | 3300042615 | Bacteria | 19267 |
| 18 | Ga0466715_115544 | 3300042616 | Bacteria | 5159 |
| 19 | Ga0466715_589396 | 3300042616 | Bacteria | 12774 |
| 20 | Ga0466723_076641 | 3300042618 | Bacteria | 2291 |
| 21 | Ga0466723_210186 | 3300042618 | Bacteria | 25414 |
| 22 | Ga0466726_040212 | 3300042619 | Bacteria | 1319 |
| 23 | Ga0466726_080442 | 3300042619 | Unclassified | 2375 |
| 24 | Ga0466728_037252 | 3300042620 | Bacteria | 4804 |
| 25 | Ga0466735_163956 | 3300042624 | Bacteria | 4295 |
| 26 | Ga0466730_024065 | 3300042625 | Bacteria | 4918 |
| 27 | Ga0466703_022339 | 3300042636 | Bacteria | 4866 |
| 28 | Ga0466703_246795 | 3300042636 | Bacteria | 3844 |
| 29 | Ga0466703_291043 | 3300042636 | Bacteria | 27662 |
| 30 | Ga0466704_171915 | 3300042643 | Bacteria | 17392 |
| 31 | Ga0466708_034052 | 3300042652 | Bacteria | 11502 |
| 32 | Ga0466708_235488 | 3300042652 | Bacteria | 24641 |
| 33 | Ga0466727_033569 | 3300042655 | Bacteria | 1374 |
| 34 | Ga0466727_055911 | 3300042655 | Bacteria | 9680 |
| 35 | Ga0466727_168576 | 3300042655 | Bacteria | 50187 |
| 36 | Ga0466727_284531 | 3300042655 | Bacteria | 2715 |
| 37 | 2227499348 | 2225789004 | Bacteria | 3840 |
| 38 | IMNBL1DRAFT_c0001037 | 3300000062 | Bacteria | 21542 |
| 39 | HBC_ctgsDRAFT_1000021 | 3300000333 | Bacteria | 41129 |
| 40 | JGI24699J35502_11133961 | 3300002509 | Bacteria | 21589 |
| 41 | Ga0123357_10000516 | 3300009784 | Bacteria | 37764 |
| 42 | Ga0466690_021263 | 3300042590 | Bacteria | 26590 |
| 43 | Ga0466692_108647 | 3300042591 | Bacteria | 182579 |
| 44 | Ga0466693_436085 | 3300042592 | Bacteria | 47244 |
| 45 | Ga0466691_002391 | 3300042593 | Bacteria | 13503 |
| 46 | Ga0466691_061637 | 3300042593 | Bacteria | 7398 |
| 47 | Ga0466696_357046 | 3300042596 | Bacteria | 2774 |
| 48 | Ga0466733_165589 | 3300042659 | Bacteria | 3618 |
| 49 | Ga0123357_10025383 | 3300009784 | Bacteria | 7994 |
| 50 | Ga0123354_10052481 | 3300010882 | Bacteria | 6143 |
| 51 | Ga0466701_077794 | 3300042598 | Bacteria | 3000 |
| 52 | Ga0466706_072816 | 3300042599 | Bacteria | 14939 |
| 53 | Ga0466706_123047 | 3300042599 | Bacteria | 432554 |
| 54 | Ga0466707_166065 | 3300042601 | Bacteria | 4464 |
| 55 | Ga0466707_175744 | 3300042601 | Bacteria | 2562 |
| 56 | Ga0466713_003599 | 3300042602 | Bacteria | 23204 |
| 57 | Ga0466713_025514 | 3300042602 | Bacteria | 114544 |
| 58 | Ga0466713_102098 | 3300042602 | Bacteria | 100663 |
| 59 | Ga0466713_115233 | 3300042602 | Bacteria | 28611 |
| 60 | Ga0466713_152232 | 3300042602 | Bacteria | 2576 |
| 61 | Ga0466714_041375 | 3300042603 | Bacteria | 2346 |
| 62 | Ga0466714_093285 | 3300042603 | Bacteria | 105352 |
| 63 | Ga0466714_168231 | 3300042603 | Bacteria | 1970 |
| 64 | Ga0466716_220507 | 3300042605 | Bacteria | 7082 |
| 65 | Ga0466719_264196 | 3300042606 | Bacteria | 2690 |
| 66 | Ga0466719_439434 | 3300042606 | Bacteria | 7674 |
| 67 | Ga0466722_082699 | 3300042609 | Bacteria | 8879 |
| 68 | Ga0466722_113848 | 3300042609 | Bacteria | 5259 |
| 69 | Ga0466711_052241 | 3300042615 | Bacteria | 11251 |
| 70 | Ga0466711_105740 | 3300042615 | Bacteria | 6579 |
| 71 | Ga0466715_205930 | 3300042616 | Bacteria | 1845 |
| 72 | Ga0466715_289503 | 3300042616 | Bacteria | 56247 |
| 73 | Ga0466715_481108 | 3300042616 | Bacteria | 8921 |
| 74 | Ga0466723_050781 | 3300042618 | Bacteria | 17839 |
| 75 | Ga0466723_093572 | 3300042618 | Bacteria | 20624 |
| 76 | Ga0466723_322524 | 3300042618 | Bacteria | 2486 |
| 77 | Ga0466726_392463 | 3300042619 | Bacteria | 6420 |
| 78 | Ga0466728_248227 | 3300042620 | Bacteria | 3936 |
| 79 | Ga0466728_383536 | 3300042620 | Bacteria | 12069 |
| 80 | Ga0466729_135755 | 3300042621 | Bacteria | 9679 |
| 81 | Ga0466735_018793 | 3300042624 | Bacteria | 5909 |
| 82 | Ga0466735_110298 | 3300042624 | Bacteria | 4907 |
| 83 | Ga0466703_057153 | 3300042636 | Bacteria | 14977 |
| 84 | Ga0466704_011043 | 3300042643 | Bacteria | 1676 |
| 85 | Ga0466704_142575 | 3300042643 | Bacteria | 2180 |
| 86 | Ga0466708_033170 | 3300042652 | Bacteria | 3492 |
| 87 | Ga0466708_232699 | 3300042652 | Bacteria | 12793 |
| 88 | 2227073844 | 2225789003 | Unclassified | 2434 |
| 89 | IMNBL1DRAFT_c0001944 | 3300000062 | Bacteria | 14890 |
| 90 | IMNBL1DRAFT_c0003946 | 3300000062 | Bacteria | 9176 |
| 91 | JGI24702J35022_10117677 | 3300002462 | Bacteria | 1466 |
| 92 | JGI24699J35502_11133642 | 3300002509 | Bacteria | 12864 |
| 93 | JGI24699J35502_11134110 | 3300002509 | Bacteria | 31696 |
| 94 | JGI24696J40584_12961541 | 3300002834 | Bacteria | 20299 |
| 95 | Ga0072941_1026738 | 3300005201 | Bacteria | 9045 |
| 96 | Ga0466690_027027 | 3300042590 | Bacteria | 9640 |
| 97 | Ga0466690_269123 | 3300042590 | Bacteria | 14586 |
| 98 | Ga0466692_128376 | 3300042591 | Bacteria | 43265 |
| 99 | Ga0466693_178234 | 3300042592 | Bacteria | 2002 |
| 100 | Ga0466696_128594 | 3300042596 | Bacteria | 10984 |
| 101 | Ga0466696_452593 | 3300042596 | Bacteria | 13411 |
| 102 | Ga0466705_252984 | 3300042612 | Bacteria | 2715 |
| 103 | Ga0466733_115891 | 3300042659 | Unclassified | 7205 |
| 104 | Ga0123354_10144380 | 3300010882 | Bacteria | 2923 |
| 105 | Ga0123354_10233386 | 3300010882 | Bacteria | 1916 |
| 106 | Ga0466706_126888 | 3300042599 | Bacteria | 36938 |
| 107 | Ga0466700_044713 | 3300042600 | Bacteria | 11766 |
| 108 | Ga0466707_092998 | 3300042601 | Bacteria | 1553 |
| 109 | Ga0466713_149989 | 3300042602 | Bacteria | 6541 |
| 110 | Ga0466719_247195 | 3300042606 | Bacteria | 2194 |
| 111 | Ga0466722_085651 | 3300042609 | Bacteria | 9043 |
| 112 | Ga0466722_214011 | 3300042609 | Bacteria | 2956 |
| 113 | Ga0466705_417481 | 3300042612 | Bacteria | 15438 |
| 114 | Ga0466711_066483 | 3300042615 | Bacteria | 17172 |
| 115 | Ga0466711_069341 | 3300042615 | Bacteria | 69315 |
| 116 | Ga0466711_074687 | 3300042615 | Bacteria | 3881 |
| 117 | Ga0466711_308404 | 3300042615 | Bacteria | 17331 |
| 118 | Ga0466715_045980 | 3300042616 | Bacteria | 33517 |
| 119 | Ga0466715_397213 | 3300042616 | Bacteria | 16485 |
| 120 | Ga0466715_429290 | 3300042616 | Bacteria | 2238 |
| 121 | Ga0466715_474747 | 3300042616 | Bacteria | 3232 |
| 122 | Ga0466723_100014 | 3300042618 | Bacteria | 3969 |
| 123 | Ga0466723_129513 | 3300042618 | Bacteria | 70343 |
| 124 | Ga0466728_107128 | 3300042620 | Bacteria | 57029 |
| 125 | Ga0466729_031481 | 3300042621 | Bacteria | 3475 |
| 126 | Ga0466729_042202 | 3300042621 | Bacteria | 3163 |
| 127 | Ga0466729_106410 | 3300042621 | Bacteria | 6208 |
| 128 | Ga0466735_034168 | 3300042624 | Bacteria | 7137 |
| 129 | Ga0466735_053767 | 3300042624 | Bacteria | 1417 |
| 130 | Ga0466703_294392 | 3300042636 | Bacteria | 5397 |
| 131 | Ga0466704_086702 | 3300042643 | Bacteria | 9037 |
| 132 | Ga0466704_101361 | 3300042643 | Bacteria | 1986 |
| 133 | Ga0466704_205152 | 3300042643 | Bacteria | 2836 |
| 134 | Ga0466704_229792 | 3300042643 | Bacteria | 44121 |
| 135 | Ga0466704_339615 | 3300042643 | Bacteria | 9464 |
| 136 | Ga0466704_358184 | 3300042643 | Unclassified | 2256 |
| 137 | Ga0466704_501980 | 3300042643 | Bacteria | 4656 |
| 138 | Ga0466709_047096 | 3300042648 | Bacteria | 173163 |
| 139 | Ga0466709_302058 | 3300042648 | Bacteria | 17795 |
| 140 | Ga0466708_214081 | 3300042652 | Bacteria | 27299 |
| 141 | Ga0466725_350213 | 3300042654 | Bacteria | 33385 |
| 142 | Ga0466725_376735 | 3300042654 | Bacteria | 6114 |
| 143 | 2227150261 | 2225789004 | Unclassified | 8537 |
| 144 | 2227577118 | 2225789004 | Bacteria | 2550 |
| 145 | IMNBL1DRAFT_c0002276 | 3300000062 | Bacteria | 13520 |
| 146 | IMNBL1DRAFT_c0031111 | 3300000062 | Bacteria | 1946 |
| 147 | JGI24702J35022_10024217 | 3300002462 | Bacteria | 3280 |
| 148 | Ga0123357_10000658 | 3300009784 | Bacteria | 34456 |
| 149 | Ga0466656_008367 | 3300042550 | Bacteria | 15930 |
| 150 | Ga0466690_250711 | 3300042590 | Bacteria | 19853 |
| 151 | Ga0466692_034904 | 3300042591 | Bacteria | 8281 |
| 152 | Ga0466692_035698 | 3300042591 | Bacteria | 28126 |
| 153 | Ga0466692_055073 | 3300042591 | Bacteria | 8431 |
| 154 | Ga0466693_099652 | 3300042592 | Bacteria | 4507 |
| 155 | Ga0466691_002166 | 3300042593 | Bacteria | 21986 |
| 156 | Ga0466691_038820 | 3300042593 | Bacteria | 14697 |
| 157 | Ga0466691_163416 | 3300042593 | Bacteria | 43349 |
| 158 | Ga0466695_289801 | 3300042595 | Bacteria | 2912 |
| 159 | Ga0466696_404794 | 3300042596 | Bacteria | 8686 |
| 160 | Ga0466705_023793 | 3300042612 | Bacteria | 5752 |
| 161 | Ga0562377_0004 | 3300056842 | Bacteria | 3525959 |
| 162 | Ga0123357_10005111 | 3300009784 | Bacteria | 15639 |
| 163 | Ga0123356_10252619 | 3300010049 | Bacteria | 1842 |
| 164 | Ga0123354_10000186 | 3300010882 | Bacteria | 52457 |
| 165 | Ga0466706_068976 | 3300042599 | Bacteria | 62328 |
| 166 | Ga0466706_082746 | 3300042599 | Unclassified | 8043 |
| 167 | Ga0466706_129682 | 3300042599 | Bacteria | 50477 |
| 168 | Ga0466713_023333 | 3300042602 | Bacteria | 13378 |
| 169 | Ga0466716_480618 | 3300042605 | Bacteria | 1668 |
| 170 | Ga0466722_042384 | 3300042609 | Archaea | 4896 |
| 171 | Ga0466722_229738 | 3300042609 | Bacteria | 42096 |
| 172 | Ga0466711_047945 | 3300042615 | Bacteria | 4999 |
| 173 | Ga0466711_242301 | 3300042615 | Bacteria | 5033 |
| 174 | Ga0466723_004627 | 3300042618 | Bacteria | 8771 |
| 175 | Ga0466723_231722 | 3300042618 | Bacteria | 6415 |
| 176 | Ga0466728_060173 | 3300042620 | Bacteria | 1284 |
| 177 | Ga0466729_059433 | 3300042621 | Bacteria | 2197 |
| 178 | Ga0466735_024695 | 3300042624 | Bacteria | 2095 |
| 179 | Ga0466735_197225 | 3300042624 | Bacteria | 5022 |
| 180 | Ga0466703_240010 | 3300042636 | Unclassified | 1393 |
| 181 | Ga0466704_270372 | 3300042643 | Bacteria | 11103 |
| 182 | Ga0466704_301653 | 3300042643 | Bacteria | 9508 |
| 183 | Ga0466704_489981 | 3300042643 | Unclassified | 2532 |
| 184 | Ga0466704_503746 | 3300042643 | Bacteria | 19685 |
| 185 | Ga0466709_064284 | 3300042648 | Bacteria | 13198 |
| 186 | Ga0466709_267738 | 3300042648 | Bacteria | 7120 |
| 187 | Ga0466709_342671 | 3300042648 | Bacteria | 8560 |
| 188 | Ga0466727_133430 | 3300042655 | Bacteria | 79695 |
| 189 | Ga0466727_182786 | 3300042655 | Bacteria | 3699 |
| 190 | 2227552426 | 2225789004 | Unclassified | 2830 |
| 191 | IMNBL1DRAFT_c0010463 | 3300000062 | Bacteria | 4436 |
| 192 | JGI24695J34938_10000007 | 3300002450 | Bacteria | 136740 |
| 193 | JGI24699J35502_11133259 | 3300002509 | Bacteria | 9499 |
| 194 | JGI24696J40584_12941213 | 3300002834 | Bacteria | 1701 |
| 195 | Ga0466690_066012 | 3300042590 | Bacteria | 9992 |
| 196 | Ga0466690_094318 | 3300042590 | Bacteria | 4424 |
| 197 | Ga0466690_149899 | 3300042590 | Bacteria | 20818 |
| 198 | Ga0466696_083319 | 3300042596 | Bacteria | 6441 |
| 199 | Ga0466696_151261 | 3300042596 | Bacteria | 13227 |
| 200 | Ga0466697_172265 | 3300042611 | Bacteria | 5306 |
| 201 | Ga0466733_096290 | 3300042659 | Bacteria | 9567 |
| 202 | Ga0466733_121044 | 3300042659 | Bacteria | 4612 |
| 203 | Ga0123357_10042199 | 3300009784 | Bacteria | 6203 |
| 204 | Ga0123357_10108205 | 3300009784 | Bacteria | 3556 |
| 205 | Ga0123357_10134600 | 3300009784 | Unclassified | 3062 |
| 206 | Ga0123354_10030612 | 3300010882 | Bacteria | 8449 |
| 207 | Ga0466706_001173 | 3300042599 | Unclassified | 6049 |
| 208 | Ga0466707_194915 | 3300042601 | Bacteria | 10556 |
| 209 | Ga0466707_248746 | 3300042601 | Bacteria | 12174 |
| 210 | Ga0466713_028269 | 3300042602 | Bacteria | 18251 |
| 211 | Ga0466716_109500 | 3300042605 | Bacteria | 25649 |
| 212 | Ga0466716_373488 | 3300042605 | Bacteria | 1759 |
| 213 | Ga0466722_175937 | 3300042609 | Bacteria | 3082 |
| 214 | Ga0466711_031675 | 3300042615 | Unclassified | 3256 |
| 215 | Ga0466711_083575 | 3300042615 | Bacteria | 31587 |
| 216 | Ga0466715_110861 | 3300042616 | Bacteria | 24786 |
| 217 | Ga0466715_174566 | 3300042616 | Bacteria | 20332 |
| 218 | Ga0466723_075931 | 3300042618 | Bacteria | 72847 |
| 219 | Ga0466723_104599 | 3300042618 | Bacteria | 14540 |
| 220 | Ga0466723_176734 | 3300042618 | Bacteria | 37839 |
| 221 | Ga0466729_112650 | 3300042621 | Bacteria | 9382 |
| 222 | Ga0466735_031973 | 3300042624 | Bacteria | 4690 |
| 223 | Ga0466703_062790 | 3300042636 | Bacteria | 2744 |
| 224 | Ga0466703_225930 | 3300042636 | Bacteria | 8188 |
| 225 | Ga0466703_267382 | 3300042636 | Bacteria | 5640 |
| 226 | Ga0466703_419597 | 3300042636 | Bacteria | 5595 |
| 227 | JGI24702J35022_10022854 | 3300002462 | Bacteria | 3382 |
| 228 | Ga0068302_10567715 | 3300005071 | Bacteria | 1390 |
| 229 | Ga0466690_016887 | 3300042590 | Bacteria | 6236 |
| 230 | Ga0466690_070379 | 3300042590 | Bacteria | 3344 |
| 231 | Ga0466691_029418 | 3300042593 | Bacteria | 17791 |
| 232 | Ga0466696_022329 | 3300042596 | Bacteria | 2679 |
| 233 | Ga0466701_002052 | 3300042598 | Bacteria | 2634 |
| 234 | Ga0466705_075450 | 3300042612 | Bacteria | 2982 |
| 235 | Ga0466705_338878 | 3300042612 | Bacteria | 7668 |
| 236 | Ga0466733_112889 | 3300042659 | Bacteria | 111775 |
| 237 | Ga0466733_133832 | 3300042659 | Bacteria | 13691 |
| 238 | Ga0466733_178206 | 3300042659 | Bacteria | 41805 |
| 239 | Ga0123357_10025165 | 3300009784 | Bacteria | 8025 |
| 240 | Ga0123354_10163052 | 3300010882 | Bacteria | 2634 |
| 241 | Ga0466706_134907 | 3300042599 | Bacteria | 1184 |
| 242 | Ga0466706_222781 | 3300042599 | Bacteria | 2552 |
| 243 | Ga0466707_031417 | 3300042601 | Bacteria | 6920 |
| 244 | Ga0466707_311653 | 3300042601 | Bacteria | 12538 |
| 245 | Ga0466707_369886 | 3300042601 | Bacteria | 5495 |
| 246 | Ga0466713_118123 | 3300042602 | Bacteria | 66356 |
| 247 | Ga0466714_127627 | 3300042603 | Bacteria | 3006 |
| 248 | Ga0466717_067730 | 3300042604 | Bacteria | 1799 |
| 249 | Ga0466719_059878 | 3300042606 | Bacteria | 3434 |
| 250 | Ga0466719_423267 | 3300042606 | Bacteria | 11355 |
| 251 | Ga0466722_094987 | 3300042609 | Bacteria | 24761 |
| 252 | Ga0466722_138965 | 3300042609 | Bacteria | 27161 |
| 253 | Ga0466722_176020 | 3300042609 | Bacteria | 5023 |
| 254 | Ga0466697_056567 | 3300042611 | Bacteria | 485126 |
| 255 | Ga0466711_034823 | 3300042615 | Bacteria | 24346 |
| 256 | Ga0466711_152308 | 3300042615 | Bacteria | 4877 |
| 257 | Ga0466715_160323 | 3300042616 | Bacteria | 12629 |
| 258 | Ga0466715_510538 | 3300042616 | Bacteria | 2232 |
| 259 | Ga0466715_604850 | 3300042616 | Bacteria | 13476 |
| 260 | Ga0466728_004763 | 3300042620 | Bacteria | 36943 |
| 261 | Ga0466728_098945 | 3300042620 | Bacteria | 3978 |
| 262 | Ga0466728_309110 | 3300042620 | Bacteria | 3030 |
| 263 | Ga0466735_013123 | 3300042624 | Bacteria | 24815 |
| 264 | Ga0466735_157891 | 3300042624 | Bacteria | 1446 |
| 265 | Ga0466703_017186 | 3300042636 | Bacteria | 5189 |
| 266 | Ga0466703_205010 | 3300042636 | Bacteria | 4460 |
| 267 | Ga0466703_384321 | 3300042636 | Bacteria | 2367 |
| 268 | Ga0466704_125587 | 3300042643 | Bacteria | 8682 |
| 269 | Ga0466704_126826 | 3300042643 | Bacteria | 3283 |
| 270 | Ga0466704_280213 | 3300042643 | Bacteria | 6990 |
| 271 | Ga0466704_306015 | 3300042643 | Bacteria | 16226 |
| 272 | Ga0466704_445082 | 3300042643 | Unclassified | 8324 |
| 273 | Ga0466709_003381 | 3300042648 | Bacteria | 24947 |
| 274 | Ga0466727_040432 | 3300042655 | Bacteria | 2125 |
| 275 | Ga0466727_171718 | 3300042655 | Bacteria | 3547 |
| 276 | IMNBL1DRAFT_c0031962 | 3300000062 | Bacteria | 1906 |
| 277 | Ga0072940_1379193 | 3300005200 | Bacteria | 1263 |
| 278 | Ga0456237_0000006 | 3300041968 | Bacteria | 62306 |
| 279 | Ga0466690_327331 | 3300042590 | Bacteria | 9582 |
| 280 | Ga0466692_054783 | 3300042591 | Bacteria | 29185 |
| 281 | Ga0466691_171413 | 3300042593 | Bacteria | 10413 |
| 282 | Ga0466694_401571 | 3300042594 | Bacteria | 1120 |
| 283 | Ga0466696_123075 | 3300042596 | Bacteria | 2507 |
| 284 | Ga0466705_010808 | 3300042612 | Bacteria | 2975 |
| 285 | Ga0466705_067670 | 3300042612 | Bacteria | 8645 |
| 286 | Ga0466733_076844 | 3300042659 | Bacteria | 3725 |
| 287 | Ga0466733_175226 | 3300042659 | Bacteria | 15654 |
| 288 | Ga0123354_10062928 | 3300010882 | Bacteria | 5457 |
| 289 | Ga0466706_027450 | 3300042599 | Bacteria | 28651 |
| 290 | Ga0466700_094231 | 3300042600 | Bacteria | 6040 |
| 291 | Ga0466700_426002 | 3300042600 | Bacteria | 6627 |
| 292 | Ga0466707_052615 | 3300042601 | Bacteria | 11243 |
| 293 | Ga0466707_059696 | 3300042601 | Bacteria | 5592 |
| 294 | Ga0466707_186751 | 3300042601 | Bacteria | 17799 |
| 295 | Ga0466707_319143 | 3300042601 | Bacteria | 7548 |
| 296 | Ga0466713_016019 | 3300042602 | Bacteria | 439221 |
| 297 | Ga0466713_070103 | 3300042602 | Bacteria | 5581 |
| 298 | Ga0466713_117146 | 3300042602 | Bacteria | 28917 |
| 299 | Ga0466714_009015 | 3300042603 | Bacteria | 2058 |
| 300 | Ga0466716_106207 | 3300042605 | Bacteria | 4655 |
| 301 | Ga0466716_185770 | 3300042605 | Bacteria | 5421 |
| 302 | Ga0466719_226953 | 3300042606 | Bacteria | 8759 |
| 303 | Ga0466719_358284 | 3300042606 | Bacteria | 8655 |
| 304 | Ga0466722_145294 | 3300042609 | Bacteria | 16440 |
| 305 | Ga0466705_527363 | 3300042612 | Bacteria | 8113 |
| 306 | Ga0466715_051431 | 3300042616 | Bacteria | 52249 |
| 307 | Ga0466715_098049 | 3300042616 | Bacteria | 2271 |
| 308 | Ga0466715_206841 | 3300042616 | Unclassified | 3209 |
| 309 | Ga0466715_476666 | 3300042616 | Unclassified | 1810 |
| 310 | Ga0466715_514087 | 3300042616 | Bacteria | 2880 |
| 311 | Ga0466723_110315 | 3300042618 | Bacteria | 19093 |
| 312 | Ga0466726_376304 | 3300042619 | Bacteria | 11640 |
| 313 | Ga0466728_369422 | 3300042620 | Bacteria | 4317 |
| 314 | Ga0466729_187818 | 3300042621 | Bacteria | 6476 |
| 315 | Ga0466735_039267 | 3300042624 | Bacteria | 1554 |
| 316 | Ga0466735_104343 | 3300042624 | Bacteria | 1509 |
| 317 | Ga0466735_105991 | 3300042624 | Bacteria | 3453 |
| 318 | Ga0466735_157603 | 3300042624 | Bacteria | 1589 |
| 319 | Ga0466702_314784 | 3300042635 | Bacteria | 1657 |
| 320 | Ga0466703_061591 | 3300042636 | Bacteria | 26544 |
| 321 | Ga0466703_348019 | 3300042636 | Bacteria | 9087 |
| 322 | Ga0466704_319129 | 3300042643 | Unclassified | 2184 |
| 323 | Ga0466708_044096 | 3300042652 | Bacteria | 70438 |
| 324 | Ga0466708_061610 | 3300042652 | Bacteria | 16139 |
| 325 | Ga0466708_176079 | 3300042652 | Bacteria | 4534 |
| 326 | Ga0466708_183984 | 3300042652 | Bacteria | 148491 |
| 327 | Ga0466727_013774 | 3300042655 | Bacteria | 6781 |
| 328 | Ga0466727_193729 | 3300042655 | Bacteria | 20278 |
| 329 | 2226980369 | 2225789003 | Bacteria | 34607 |
| 330 | IMNBL1DRAFT_c0008642 | 3300000062 | Bacteria | 5159 |
| 331 | JGI24702J35022_10002195 | 3300002462 | Bacteria | 12022 |
| 332 | JGI24702J35022_10008903 | 3300002462 | Bacteria | 5660 |
| 333 | JGI24705J35276_12238275 | 3300002504 | Bacteria | 18435 |
| 334 | Ga0068305_10037570 | 3300005083 | Bacteria | 3297 |
| 335 | Ga0068305_10052284 | 3300005083 | Bacteria | 8029 |
| 336 | Ga0466690_014363 | 3300042590 | Bacteria | 61479 |
| 337 | Ga0466690_329789 | 3300042590 | Bacteria | 12251 |
| 338 | Ga0466690_352250 | 3300042590 | Bacteria | 2082 |
| 339 | Ga0466692_155585 | 3300042591 | Bacteria | 17066 |
| 340 | Ga0466691_012111 | 3300042593 | Bacteria | 11113 |
| 341 | Ga0466691_216969 | 3300042593 | Bacteria | 13078 |
| 342 | Ga0466696_485112 | 3300042596 | Bacteria | 7496 |
| 343 | Ga0466699_254167 | 3300042597 | Bacteria | 1424 |
| 344 | Ga0466705_165190 | 3300042612 | Bacteria | 5377 |
| 345 | Ga0466733_012710 | 3300042659 | Bacteria | 11988 |
| 346 | Ga0466733_110982 | 3300042659 | Bacteria | 43063 |
| 347 | Ga0123357_10018522 | 3300009784 | Bacteria | 9259 |
| 348 | Ga0466706_136257 | 3300042599 | Bacteria | 11502 |
| 349 | Ga0466700_287722 | 3300042600 | Bacteria | 5900 |
| 350 | Ga0466713_051716 | 3300042602 | Bacteria | 14617 |
| 351 | Ga0466713_151704 | 3300042602 | Bacteria | 1887 |
| 352 | Ga0466716_038373 | 3300042605 | Bacteria | 9102 |
| 353 | Ga0466716_262919 | 3300042605 | Bacteria | 4190 |
| 354 | Ga0466716_326732 | 3300042605 | Bacteria | 9278 |
| 355 | Ga0466722_117342 | 3300042609 | Bacteria | 2424 |
| 356 | Ga0466698_307967 | 3300042610 | Bacteria | 2768 |
| 357 | Ga0466711_083771 | 3300042615 | Bacteria | 17761 |
| 358 | Ga0466711_261358 | 3300042615 | Bacteria | 5541 |
| 359 | Ga0466715_289675 | 3300042616 | Bacteria | 35409 |
| 360 | Ga0466715_422874 | 3300042616 | Unclassified | 2024 |
| 361 | Ga0466726_203345 | 3300042619 | Bacteria | 4851 |
| 362 | Ga0466726_336567 | 3300042619 | Bacteria | 3842 |
| 363 | Ga0466726_434748 | 3300042619 | Bacteria | 7074 |
| 364 | Ga0466728_402448 | 3300042620 | Bacteria | 13423 |
| 365 | Ga0466735_233540 | 3300042624 | Bacteria | 1360 |
| 366 | Ga0466703_249270 | 3300042636 | Bacteria | 21168 |
| 367 | Ga0466704_197651 | 3300042643 | Unclassified | 3289 |
| 368 | Ga0466708_011343 | 3300042652 | Bacteria | 5399 |
| 369 | Ga0466727_126471 | 3300042655 | Bacteria | 9058 |
| 370 | Ga0466727_129066 | 3300042655 | Bacteria | 3105 |
| 371 | 2227619054 | 2225789004 | Bacteria | 45751 |
| 372 | IMNBL1DRAFT_c0000734 | 3300000062 | Bacteria | 25991 |
| 373 | IMNBL1DRAFT_c0002451 | 3300000062 | Bacteria | 12903 |
| 374 | IMNBL1DRAFT_c0033076 | 3300000062 | Bacteria | 1856 |
| 375 | JGI24702J35022_10001433 | 3300002462 | Bacteria | 14894 |
| 376 | Ga0466657_347258 | 3300042582 | Bacteria | 4787 |
| 377 | Ga0466690_031196 | 3300042590 | Bacteria | 10289 |
| 378 | Ga0466691_013990 | 3300042593 | Bacteria | 39551 |
| 379 | Ga0466691_035834 | 3300042593 | Bacteria | 29865 |
| 380 | Ga0466696_124388 | 3300042596 | Bacteria | 36262 |
| 381 | Ga0466696_329890 | 3300042596 | Bacteria | 3319 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00106 | adh_short | short chain dehydrogenase | 63 | 133 | 0.9 |
| PF04321 | RmlD_sub_bind | RmlD substrate binding domain | 63 | 226 | 0.9 |
| PF16363 | GDP_Man_Dehyd | GDP-mannose 4,6 dehydratase | 65 | 388 | 0.89 |
| PF01370 | Epimerase | NAD dependent epimerase/dehydratase family | 64 | 317 | 0.88 |
| PF01073 | 3Beta_HSD | 3-beta hydroxysteroid dehydrogenase/isomerase family | 65 | 225 | 0.86 |
| PF02719 | Polysacc_synt_2 | Polysaccharide biosynthesis protein | 64 | 186 | 0.85 |
| PF08659 | KR | KR domain | 64 | 146 | 0.8 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.