Protein Family IF07205
Metagenome
Isolate
110
Members
41
Samples
107
Scaffolds
235.94
Avg Length
Representative Sequence
- ID
- 3300042612|Ga0466705_369316|Ga0466705_369316_1651_2355
- Length
- 218 aa
- Sequence
- MTLYTCKDAALGYEGSVAVRGLNFEVRSGDYLCIAGENGSGKSTLLKGLLQLKTPVEGSILLGVNADEIGYLPQQTAAQKDFPASAYEVVLSGRISSRGILPFYSRKDRLTANENIERLGIKPLRNRCYRELSGGQLLLDEPAAGLDPVIIKELYRLIENINHETGVTVIMVSHDISSAVKYASHILHLKTEQLFFGTTSDYLNSPFGKMFAGGESND
Sample Types
Isolate
2.7%
Metagenome
97.3%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
41.0%
Kalotermitidae
25.6%
Unclassified
15.4%
Rhinotermitidae
5.1%
Passalidae
5.1%
Termopsidae
5.1%
Hodotermitidae
2.6%
Taxonomy
Archaea
1
Bacteria
105
Eukaryota
0
Viruses
0
Unclassified
4
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 2 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 3 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 4 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 5 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 6 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 7 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 8 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 9 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 10 | 2820344559 | Unclassified Firmicutes Nt197P3bin63 | Isolate | Unclassified |
| 11 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 12 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 13 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 14 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 15 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 16 | 2820487239 | Unclassified Firmicutes Lab288P1bin71 | Isolate | Unclassified |
| 17 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 18 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 19 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 20 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 21 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 22 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 23 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 24 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 25 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 26 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 27 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 28 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 29 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 30 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 31 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 32 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 33 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 34 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 35 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 36 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 37 | 2740892547 | Fibrobacteria bacterium GUT77 MC_77 | Isolate | Unclassified |
| 38 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 39 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 40 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 41 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_262170 | 3300042612 | Bacteria | 1068 |
| 2 | Ga0466706_267220 | 3300042599 | Bacteria | 3695 |
| 3 | Ga0466706_279853 | 3300042599 | Bacteria | 7402 |
| 4 | Ga0466706_288275 | 3300042599 | Bacteria | 4852 |
| 5 | Ga0466707_040188 | 3300042601 | Bacteria | 7061 |
| 6 | Ga0466707_113183 | 3300042601 | Bacteria | 1949 |
| 7 | Ga0466707_377132 | 3300042601 | Bacteria | 23966 |
| 8 | Ga0466717_213287 | 3300042604 | Bacteria | 1700 |
| 9 | Ga0466719_049955 | 3300042606 | Bacteria | 15529 |
| 10 | Ga0466726_196628 | 3300042619 | Bacteria | 1252 |
| 11 | AustNasuHG_c1000017 | 3300000089 | Bacteria | 39007 |
| 12 | Ga0072941_1011884 | 3300005201 | Bacteria | 4515 |
| 13 | Ga0074263_105203 | 3300005485 | Bacteria | 3242 |
| 14 | Ga0466704_308085 | 3300042643 | Bacteria | 1393 |
| 15 | Ga0466706_116541 | 3300042599 | Bacteria | 20078 |
| 16 | Ga0466706_218628 | 3300042599 | Bacteria | 4378 |
| 17 | Ga0466707_006763 | 3300042601 | Bacteria | 1910 |
| 18 | Ga0466707_145716 | 3300042601 | Bacteria | 2670 |
| 19 | Ga0466707_363519 | 3300042601 | Bacteria | 36337 |
| 20 | Ga0466722_185581 | 3300042609 | Bacteria | 4779 |
| 21 | Ga0466715_500580 | 3300042616 | Bacteria | 20540 |
| 22 | Ga0466723_114388 | 3300042618 | Bacteria | 4123 |
| 23 | Ga0466695_163591 | 3300042595 | Bacteria | 1779 |
| 24 | Ga0466704_293813 | 3300042643 | Unclassified | 6384 |
| 25 | Ga0466704_390529 | 3300042643 | Bacteria | 15315 |
| 26 | Ga0466727_029128 | 3300042655 | Bacteria | 6876 |
| 27 | Ga0466727_116993 | 3300042655 | Bacteria | 7422 |
| 28 | Ga0466705_377825 | 3300042612 | Bacteria | 346954 |
| 29 | Ga0466732_247512 | 3300042656 | Bacteria | 4915 |
| 30 | Ga0123353_10491690 | 3300010167 | Bacteria | 1791 |
| 31 | Ga0466706_005347 | 3300042599 | Bacteria | 25996 |
| 32 | Ga0466707_000904 | 3300042601 | Bacteria | 21612 |
| 33 | Ga0466707_184672 | 3300042601 | Bacteria | 2217 |
| 34 | Ga0466707_225336 | 3300042601 | Bacteria | 1068 |
| 35 | Ga0466719_336472 | 3300042606 | Bacteria | 54006 |
| 36 | Ga0466698_072423 | 3300042610 | Bacteria | 1449 |
| 37 | Ga0466726_159593 | 3300042619 | Bacteria | 3549 |
| 38 | Ga0466728_222807 | 3300042620 | Unclassified | 5856 |
| 39 | Ga0466728_304259 | 3300042620 | Bacteria | 1033 |
| 40 | Ga0466696_395201 | 3300042596 | Bacteria | 1335 |
| 41 | Ga0466696_487174 | 3300042596 | Bacteria | 2139 |
| 42 | 2227516298 | 2225789004 | Bacteria | 17756 |
| 43 | Ga0072940_1049876 | 3300005200 | Bacteria | 2445 |
| 44 | Ga0072940_1255291 | 3300005200 | Bacteria | 1239 |
| 45 | Ga0466703_419060 | 3300042636 | Bacteria | 6308 |
| 46 | Ga0466704_258529 | 3300042643 | Bacteria | 10623 |
| 47 | Ga0466704_590902 | 3300042643 | Bacteria | 1397 |
| 48 | Ga0123356_10100294 | 3300010049 | Bacteria | 2777 |
| 49 | Ga0466706_125359 | 3300042599 | Bacteria | 4908 |
| 50 | Ga0466706_148360 | 3300042599 | Unclassified | 5059 |
| 51 | Ga0466706_222771 | 3300042599 | Bacteria | 3787 |
| 52 | Ga0466707_123840 | 3300042601 | Bacteria | 1218 |
| 53 | Ga0466707_209388 | 3300042601 | Bacteria | 61599 |
| 54 | Ga0466707_211664 | 3300042601 | Bacteria | 1670 |
| 55 | Ga0466698_367139 | 3300042610 | Bacteria | 4801 |
| 56 | Ga0466705_409893 | 3300042612 | Bacteria | 6468 |
| 57 | Ga0466726_019370 | 3300042619 | Bacteria | 13266 |
| 58 | JGI24698J34947_10005252 | 3300002449 | Bacteria | 7107 |
| 59 | Ga0466733_189701 | 3300042659 | Bacteria | 6576 |
| 60 | Ga0123355_10211398 | 3300009826 | Bacteria | 2810 |
| 61 | Ga0466706_011658 | 3300042599 | Bacteria | 106800 |
| 62 | Ga0466706_051011 | 3300042599 | Bacteria | 2453 |
| 63 | Ga0466707_018711 | 3300042601 | Bacteria | 29522 |
| 64 | Ga0466707_183297 | 3300042601 | Bacteria | 10712 |
| 65 | Ga0466707_336099 | 3300042601 | Bacteria | 1490 |
| 66 | Ga0466707_349007 | 3300042601 | Bacteria | 1223 |
| 67 | Ga0466707_415810 | 3300042601 | Bacteria | 8330 |
| 68 | Ga0466713_056686 | 3300042602 | Bacteria | 29399 |
| 69 | Ga0466713_064550 | 3300042602 | Bacteria | 2483 |
| 70 | Ga0466722_220963 | 3300042609 | Bacteria | 51259 |
| 71 | Ga0466711_327482 | 3300042615 | Bacteria | 1751 |
| 72 | Ga0466726_044174 | 3300042619 | Bacteria | 11791 |
| 73 | Ga0466726_414326 | 3300042619 | Bacteria | 1627 |
| 74 | Ga0466729_155686 | 3300042621 | Bacteria | 8567 |
| 75 | 2227516297 | 2225789004 | Bacteria | 17760 |
| 76 | Ga0466705_295445 | 3300042612 | Bacteria | 47808 |
| 77 | Ga0123355_10305137 | 3300009826 | Bacteria | 2165 |
| 78 | Ga0466706_114391 | 3300042599 | Bacteria | 19360 |
| 79 | Ga0466706_200904 | 3300042599 | Archaea | 3583 |
| 80 | Ga0466707_159488 | 3300042601 | Bacteria | 28728 |
| 81 | Ga0466711_473735 | 3300042615 | Bacteria | 15279 |
| 82 | Ga0466726_392007 | 3300042619 | Bacteria | 6816 |
| 83 | Ga0466704_316307 | 3300042643 | Bacteria | 1755 |
| 84 | Ga0466704_591146 | 3300042643 | Unclassified | 1440 |
| 85 | Ga0466708_122583 | 3300042652 | Bacteria | 31842 |
| 86 | Ga0466705_369316 | 3300042612 | Bacteria | 39792 |
| 87 | Ga0466706_246919 | 3300042599 | Bacteria | 13895 |
| 88 | Ga0466707_180084 | 3300042601 | Bacteria | 1920 |
| 89 | Ga0466713_014037 | 3300042602 | Bacteria | 2125 |
| 90 | Ga0466722_000322 | 3300042609 | Bacteria | 6707 |
| 91 | Ga0466711_001859 | 3300042615 | Bacteria | 4880 |
| 92 | Ga0466726_290279 | 3300042619 | Bacteria | 2134 |
| 93 | Ga0466729_011630 | 3300042621 | Bacteria | 2417 |
| 94 | Ga0264413_121116 | 3300024493 | Bacteria | 1850 |
| 95 | Ga0466696_251879 | 3300042596 | Bacteria | 3188 |
| 96 | Ga0466706_132612 | 3300042599 | Bacteria | 2432 |
| 97 | Ga0466707_011978 | 3300042601 | Bacteria | 1510 |
| 98 | Ga0466714_144585 | 3300042603 | Bacteria | 3758 |
| 99 | Ga0466720_023232 | 3300042607 | Bacteria | 31127 |
| 100 | Ga0466722_021646 | 3300042609 | Bacteria | 15821 |
| 101 | Ga0466715_540871 | 3300042616 | Bacteria | 9367 |
| 102 | Ga0466718_069793 | 3300042617 | Bacteria | 31186 |
| 103 | Ga0466726_039665 | 3300042619 | Bacteria | 1087 |
| 104 | IMNBL1DRAFT_c0002674 | 3300000062 | Bacteria | 12182 |
| 105 | Ga0068305_10089091 | 3300005083 | Bacteria | 2568 |
| 106 | Ga0466702_438526 | 3300042635 | Bacteria | 2315 |
| 107 | Ga0466703_257393 | 3300042636 | Bacteria | 5372 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.