Protein Family IF07152
Metagenome
Isolate
212
Members
146
Samples
122
Scaffolds
377.28
Avg Length
Representative Sequence
- ID
- 3300042612|Ga0466705_232907|Ga0466705_232907_5377_6735
- Length
- 452 aa
- Sequence
- MNGWQSVTSRSGDRVGSTKVDTLIFTHRPYYKSKPVAAKHVPLIFHNFAFLFFLRNLIKGKIAAGLSGGVDSSVAAWLLKQQGYDLLGLFMINWRETTGTLSGDCPWEDDVIFARLVARKLDIPFEVVDLSDSYRRRVVDYMFEEYRCGRTPNPDVLCNREIKFDMFARAAFDRGANYVATGHYCRKETVTVDGKEMHRLLAGVDPGKDQNYFLCQLSQQQLATALFPIGHLMKSEVRRIAEENGLATARRKDSQGICFVGKVDLPVFLQQKLKAKDGVIVEIPAGFEGFNRMIPEDNLHEKLKILATPYSYMPTDGRIVGKHRGAHFFTVGQRKGLNVGGMAEPLFVIGIDVENNVVYAGQGDSHPGLYHSALFVSAKEIHWIRPDLEMQPGDKCRMSVRVRYRQPLQDATLYRMPEGMYILFDQPQRSIAPGQFAAWYNGDELTGSGVIN
Sample Types
Isolate
42.5%
Metagenome
57.5%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Apidae
48.6%
Termitidae
12.0%
Unclassified
11.3%
Kalotermitidae
9.9%
Formicidae
4.9%
Armadillidiidae
2.8%
Rhinotermitidae
2.8%
Aphididae
2.1%
Termopsidae
2.1%
Glossinidae
0.7%
Passalidae
0.7%
Elmidae
0.7%
Monophlebidae
0.7%
Hodotermitidae
0.7%
Taxonomy
Archaea
0
Bacteria
200
Eukaryota
0
Viruses
0
Unclassified
12
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2585427850 | Snodgrassella alvi wkB12 | Isolate | Apidae |
| 2 | 2811994808 | Snodgrassella alvi Sa_196 v2 | Isolate | Unclassified |
| 3 | 2820157249 | Unclassified Proteobacteria Cu122P4bin11 | Isolate | Unclassified |
| 4 | 2820161938 | Unclassified Proteobacteria Cu122P3bin14 | Isolate | Unclassified |
| 5 | 2820744581 | Unclassified Bacteroidetes Th196P3bin138 | Isolate | Unclassified |
| 6 | 2846361553 | Snodgrassella alvi PEB0171 | Isolate | Apidae |
| 7 | 2846861257 | Buchnera aphidicola LSU | Isolate | Aphididae |
| 8 | 2849417936 | Snodgrassella alvi N9 | Isolate | Apidae |
| 9 | 2852205774 | Snodgrassella alvi ESL0196 | Isolate | Apidae |
| 10 | 2854086477 | Snodgrassella alvi N-S3 | Isolate | Apidae |
| 11 | 2854097802 | Snodgrassella alvi Aw-18 | Isolate | Apidae |
| 12 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 13 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 14 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 15 | 8101265296 | Snodgrassella sp. W8158 | Isolate | Apidae |
| 16 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 17 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 18 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 19 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 20 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 21 | 2820164216 | Unclassified Proteobacteria Cu122P1bin22 | Isolate | Unclassified |
| 22 | 2834412944 | Snodgrassella alvi A-5-24 | Isolate | Apidae |
| 23 | 2834415282 | Snodgrassella alvi Occ4-2 | Isolate | Apidae |
| 24 | 2846359427 | Snodgrassella alvi wkB273 | Isolate | Apidae |
| 25 | 2848339753 | Ephemeroptericola cinctiostellae F02 | Isolate | Unclassified |
| 26 | 2857825141 | Snodgrassella alvi wkB332 | Isolate | Apidae |
| 27 | 2857830159 | Snodgrassella alvi A-9-24 | Isolate | Apidae |
| 28 | 2868464004 | Snodgrassella alvi Pens2-2-5 | Isolate | Apidae |
| 29 | 3300007188 | Ant gut microbial communities from Cephalotes rohweri, Arizona, USA | Metagenome | Formicidae |
| 30 | 3300012824 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG | Metagenome | Armadillidiidae |
| 31 | 649633028 | Candidatus Blochmannia vafer BVAF | Isolate | Formicidae |
| 32 | 8101258116 | Snodgrassella sp. M0112 | Isolate | Apidae |
| 33 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 34 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 35 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 36 | 2511231135 | Wigglesworthia glossinidia endosymbiont of Glossina morsitans | Isolate | Glossinidae |
| 37 | 2684622927 | Snodgrassella alvi Sa_196 | Isolate | Unclassified |
| 38 | 2687453753 | Burkholderiales bacterium B_Cag25 | Isolate | Unclassified |
| 39 | 2837563510 | Snodgrassella alvi N-S1 | Isolate | Apidae |
| 40 | 2843299038 | Snodgrassella alvi N-S2 | Isolate | Apidae |
| 41 | 2846368606 | Snodgrassella alvi A-11-12 | Isolate | Apidae |
| 42 | 2849404451 | Snodgrassella alvi E1 | Isolate | Apidae |
| 43 | 2854088767 | Snodgrassella alvi MS1-3 | Isolate | Apidae |
| 44 | 2854104879 | Snodgrassella alvi Fer2-2 | Isolate | Apidae |
| 45 | 2857840086 | Snodgrassella alvi Aw-20 | Isolate | Apidae |
| 46 | 2868461634 | Snodgrassella alvi Gris2-3-4 | Isolate | Apidae |
| 47 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 48 | 3300002938 | Larval gut metagenome for colony PL005 | Metagenome | Formicidae |
| 49 | 3300012847 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG | Metagenome | Armadillidiidae |
| 50 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 51 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 52 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 53 | 2837560943 | Snodgrassella alvi HK3 | Isolate | Apidae |
| 54 | 2840743474 | Snodgrassella alvi N-23 | Isolate | Apidae |
| 55 | 2846366200 | Snodgrassella alvi Gris3-4 | Isolate | Apidae |
| 56 | 2846370940 | Snodgrassella alvi Nev3CBA3 | Isolate | Apidae |
| 57 | 2857842411 | Snodgrassella alvi Ruf1-X | Isolate | Apidae |
| 58 | 2864755708 | Massilia timonae S00006 | Isolate | Elmidae |
| 59 | 3300000333 | Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony | Metagenome | Apidae |
| 60 | 3300000460 | Honey bee gut microbial communities from West Haven, Conneticut, USA - Snodgrassella SCG AB-598-O02 | Metagenome | Apidae |
| 61 | 3300007142 | Ant gut microbial communities from Cephalotes grandinosus, Brazil | Metagenome | Formicidae |
| 62 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 63 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 64 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 65 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 66 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 67 | 8101255641 | Snodgrassella sp. M0110 | Isolate | Apidae |
| 68 | 8101260589 | Snodgrassella sp. M0118 | Isolate | Apidae |
| 69 | 8101267702 | Snodgrassella sp. W6238H14 | Isolate | Apidae |
| 70 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 71 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 72 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 73 | 2571042003 | Stenoxybacter acetivorans DSM 19021 | Isolate | Rhinotermitidae |
| 74 | 2585427656 | Endosymbiont of Llaveia axin axin | Isolate | Monophlebidae |
| 75 | 2585427851 | Snodgrassella alvi wkB29 | Isolate | Apidae |
| 76 | 2820071837 | Unclassified Proteobacteria Nt197P3bin132 | Isolate | Unclassified |
| 77 | 2820077244 | Unclassified Proteobacteria Lab288P4bin72 | Isolate | Unclassified |
| 78 | 2834230000 | Pandoraea novymonadis E262 | Isolate | Unclassified |
| 79 | 2846373876 | Snodgrassella alvi Gris1-3 | Isolate | Apidae |
| 80 | 2848751009 | Snodgrassella alvi App2-2 | Isolate | Apidae |
| 81 | 2849411303 | Snodgrassella alvi A3 | Isolate | Apidae |
| 82 | 2854084220 | Snodgrassella alvi Snod2-1-5 | Isolate | Apidae |
| 83 | 2854093395 | Snodgrassella alvi N-S5 | Isolate | Apidae |
| 84 | 2854102457 | Snodgrassella alvi Gris1-6 | Isolate | Apidae |
| 85 | 2857835046 | Snodgrassella alvi wkB9 | Isolate | Apidae |
| 86 | 2857845033 | Snodgrassella alvi WF3-3 | Isolate | Apidae |
| 87 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 88 | 3300005721 | Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 | Metagenome | Apidae |
| 89 | 3300012820 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E6 MG | Metagenome | Armadillidiidae |
| 90 | 3300012848 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG | Metagenome | Armadillidiidae |
| 91 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 92 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 93 | 8101274435 | Snodgrassella sp. W8134 | Isolate | Apidae |
| 94 | 8101276651 | Snodgrassella sp. W8135 | Isolate | Apidae |
| 95 | 648028015 | Candidatus Zinderia insecticola CARI | Isolate | |
| 96 | 2841132873 | Buchnera aphidicola BTs Pazieg | Isolate | Aphididae |
| 97 | 2846376288 | Snodgrassella alvi Fer4-2 | Isolate | Apidae |
| 98 | 2846379220 | Snodgrassella alvi wkB237 | Isolate | Apidae |
| 99 | 2849399727 | Snodgrassella alvi Fer1-2 | Isolate | Apidae |
| 100 | 2849402121 | Snodgrassella alvi A-10-12 | Isolate | Apidae |
| 101 | 2849409164 | Snodgrassella alvi wkB298 | Isolate | Apidae |
| 102 | 2849413536 | Snodgrassella alvi N-S4 | Isolate | Apidae |
| 103 | 2854091108 | Snodgrassella alvi wkB339 | Isolate | Apidae |
| 104 | 2854095577 | Snodgrassella alvi A12 | Isolate | Apidae |
| 105 | 2857837414 | Snodgrassella alvi App4-8 | Isolate | Apidae |
| 106 | 3300007140 | Ant gut microbial communities from Cephalotes pallens, Brazil | Metagenome | Formicidae |
| 107 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 108 | 8101272231 | Snodgrassella sp. W8132 | Isolate | Apidae |
| 109 | 2603880165 | Burkholderiales A1 | Isolate | Unclassified |
| 110 | 2603880170 | Burkholderiales A2 | Isolate | Unclassified |
| 111 | 2840748007 | Snodgrassella alvi A-1-12 | Isolate | Apidae |
| 112 | 2843301220 | Snodgrassella alvi Nev4-2 | Isolate | Apidae |
| 113 | 2846363972 | Snodgrassella alvi N-W7 | Isolate | Apidae |
| 114 | 2849406737 | Snodgrassella alvi PEB0178 | Isolate | Apidae |
| 115 | 2849415715 | Snodgrassella alvi A2 | Isolate | Apidae |
| 116 | 2857822956 | Snodgrassella alvi N-W4 | Isolate | Apidae |
| 117 | 2900804455 | Listeria sp. PSOL-1 Marseille-P4284 | Isolate | Unclassified |
| 118 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 119 | 3300012814 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E6 MG | Metagenome | |
| 120 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 121 | 8101263066 | Snodgrassella sp. M0351 | Isolate | Apidae |
| 122 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 123 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 124 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 125 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 126 | 8119099601 | Snodgrassella alvi wkB2 | Isolate | Apidae |
| 127 | 2511231158 | Buchnera aphidicola Ua | Isolate | Aphididae |
| 128 | 2585428136 | Snodgrassella alvi wkB2 | Isolate | Apidae |
| 129 | 2854100132 | Snodgrassella alvi A-2-12 | Isolate | Apidae |
| 130 | 2857827427 | Snodgrassella alvi App6-4 | Isolate | Apidae |
| 131 | 2857832487 | Snodgrassella alvi HK9x | Isolate | Apidae |
| 132 | 3300000475 | Honey bee gut microbial communities from West Haven, Conneticut, USA - Snodgrassella SCG AB-598-J21 | Metagenome | Apidae |
| 133 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 134 | 3300002934 | Ant worker gut metagenome for colony PL005 | Metagenome | Formicidae |
| 135 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 136 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 137 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 138 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 139 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 140 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 141 | 8101270055 | Snodgrassella sp. W8124 | Isolate | Apidae |
| 142 | 8101278866 | Snodgrassella sp. W6238H11 | Isolate | Apidae |
| 143 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 144 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 145 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 146 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466710_013254 | 3300042613 | Unclassified | 4597 |
| 2 | Ga0466710_064886 | 3300042613 | Bacteria | 10632 |
| 3 | Ga0466711_082267 | 3300042615 | Bacteria | 5921 |
| 4 | Ga0466723_207994 | 3300042618 | Bacteria | 6775 |
| 5 | Ga0466707_162869 | 3300042601 | Bacteria | 5824 |
| 6 | Ga0466714_019216 | 3300042603 | Bacteria | 5633 |
| 7 | Ga0123353_10025272 | 3300010167 | Bacteria | 9045 |
| 8 | Ga0123353_10164796 | 3300010167 | Bacteria | 3525 |
| 9 | Ga0123353_10238036 | 3300010167 | Bacteria | 2831 |
| 10 | Ga0160453_100431 | 3300012814 | Bacteria | 33823 |
| 11 | Ga0466690_310123 | 3300042590 | Bacteria | 33397 |
| 12 | Ga0466692_122843 | 3300042591 | Bacteria | 5828 |
| 13 | Ga0466703_424418 | 3300042636 | Bacteria | 2278 |
| 14 | Ga0466708_126823 | 3300042652 | Bacteria | 18127 |
| 15 | Ga0466727_227951 | 3300042655 | Bacteria | 12615 |
| 16 | SCG598O02_11477 | 3300000460 | Bacteria | 22561 |
| 17 | JGI24705J35276_12234209 | 3300002504 | Bacteria | 5334 |
| 18 | CVPL005L_10001289 | 3300002938 | Bacteria | 28698 |
| 19 | Ga0466723_208995 | 3300042618 | Bacteria | 7856 |
| 20 | Ga0466706_074928 | 3300042599 | Unclassified | 12090 |
| 21 | Ga0466706_187739 | 3300042599 | Bacteria | 1790 |
| 22 | Ga0466713_043282 | 3300042602 | Bacteria | 27829 |
| 23 | Ga0466719_221195 | 3300042606 | Bacteria | 4308 |
| 24 | Ga0123353_10142090 | 3300010167 | Unclassified | 3844 |
| 25 | Ga0160443_100037 | 3300012848 | Unclassified | 326441 |
| 26 | Ga0466691_076561 | 3300042593 | Bacteria | 1401 |
| 27 | Ga0466709_091194 | 3300042648 | Bacteria | 5925 |
| 28 | Ga0466708_237223 | 3300042652 | Bacteria | 15010 |
| 29 | IMNBL1DRAFT_c0007880 | 3300000062 | Bacteria | 5516 |
| 30 | CVPL010W_10021526 | 3300002931 | Bacteria | 3564 |
| 31 | Ga0072941_1144662 | 3300005201 | Bacteria | 4915 |
| 32 | Ga0102737_1006439 | 3300007142 | Bacteria | 2235 |
| 33 | Ga0103264_1000512 | 3300007188 | Unclassified | 23484 |
| 34 | Ga0103264_1000999 | 3300007188 | Bacteria | 19140 |
| 35 | Ga0466733_202355 | 3300042659 | Bacteria | 20133 |
| 36 | Ga0466711_047127 | 3300042615 | Bacteria | 7570 |
| 37 | Ga0466715_085619 | 3300042616 | Bacteria | 17658 |
| 38 | Ga0466723_348548 | 3300042618 | Bacteria | 2839 |
| 39 | Ga0466728_387061 | 3300042620 | Bacteria | 14937 |
| 40 | Ga0466706_022802 | 3300042599 | Bacteria | 1943 |
| 41 | Ga0466714_068503 | 3300042603 | Unclassified | 3187 |
| 42 | Ga0123353_10480965 | 3300010167 | Bacteria | 1817 |
| 43 | Ga0123354_10124684 | 3300010882 | Bacteria | 3299 |
| 44 | Ga0160469_100002 | 3300012824 | Bacteria | 1020748 |
| 45 | Ga0466690_236274 | 3300042590 | Bacteria | 2422 |
| 46 | Ga0466691_019534 | 3300042593 | Bacteria | 22787 |
| 47 | Ga0466701_000915 | 3300042598 | Bacteria | 15020 |
| 48 | Ga0466704_016572 | 3300042643 | Bacteria | 4282 |
| 49 | Ga0466725_456278 | 3300042654 | Bacteria | 76460 |
| 50 | Ga0102740_1001083 | 3300007140 | Bacteria | 8439 |
| 51 | Ga0103264_1000054 | 3300007188 | Bacteria | 66003 |
| 52 | Ga0466705_232907 | 3300042612 | Bacteria | 10881 |
| 53 | Ga0466728_038366 | 3300042620 | Bacteria | 11491 |
| 54 | Ga0466728_216335 | 3300042620 | Bacteria | 2140 |
| 55 | Ga0466716_135438 | 3300042605 | Bacteria | 2801 |
| 56 | Ga0123353_10044811 | 3300010167 | Bacteria | 7015 |
| 57 | Ga0160445_100092 | 3300012847 | Bacteria | 91124 |
| 58 | Ga0466692_082729 | 3300042591 | Bacteria | 9542 |
| 59 | Ga0466696_284271 | 3300042596 | Bacteria | 4260 |
| 60 | SCG598J21_11567 | 3300000475 | Bacteria | 39151 |
| 61 | CVPL010W_10017260 | 3300002931 | Unclassified | 6091 |
| 62 | CVPL005L_10024979 | 3300002938 | Bacteria | 2505 |
| 63 | Ga0074278_111318 | 3300005721 | Unclassified | 7556 |
| 64 | Ga0466697_109836 | 3300042611 | Bacteria | 4070 |
| 65 | Ga0466705_097982 | 3300042612 | Bacteria | 15803 |
| 66 | Ga0466733_179840 | 3300042659 | Bacteria | 3877 |
| 67 | Ga0466715_194603 | 3300042616 | Bacteria | 47231 |
| 68 | Ga0466726_145590 | 3300042619 | Bacteria | 9288 |
| 69 | Ga0466714_120203 | 3300042603 | Bacteria | 3398 |
| 70 | Ga0466722_060431 | 3300042609 | Bacteria | 7149 |
| 71 | Ga0466690_207500 | 3300042590 | Unclassified | 4394 |
| 72 | Ga0466696_094981 | 3300042596 | Bacteria | 4347 |
| 73 | Ga0466734_106932 | 3300042623 | Bacteria | 8397 |
| 74 | Ga0466704_526217 | 3300042643 | Bacteria | 23009 |
| 75 | Ga0466709_287029 | 3300042648 | Bacteria | 41744 |
| 76 | CVPL010W_10011848 | 3300002931 | Bacteria | 7129 |
| 77 | CVPL005W_1000027 | 3300002934 | Bacteria | 52318 |
| 78 | Ga0102737_1001447 | 3300007142 | Bacteria | 6838 |
| 79 | Ga0466714_087963 | 3300042603 | Bacteria | 1525 |
| 80 | Ga0466714_101990 | 3300042603 | Bacteria | 2096 |
| 81 | Ga0466714_150847 | 3300042603 | Bacteria | 4341 |
| 82 | Ga0466716_055048 | 3300042605 | Bacteria | 15525 |
| 83 | Ga0160456_100098 | 3300012820 | Bacteria | 100058 |
| 84 | Ga0265387_1002831 | 3300024582 | Bacteria | 2426 |
| 85 | Ga0466690_082872 | 3300042590 | Bacteria | 3592 |
| 86 | Ga0466690_150988 | 3300042590 | Bacteria | 5124 |
| 87 | Ga0466696_256912 | 3300042596 | Bacteria | 3376 |
| 88 | JGI24702J35022_10054348 | 3300002462 | Bacteria | 2136 |
| 89 | CVPL005W_1001476 | 3300002934 | Unclassified | 6155 |
| 90 | Ga0103264_1001004 | 3300007188 | Bacteria | 18322 |
| 91 | Ga0466705_047850 | 3300042612 | Bacteria | 2286 |
| 92 | Ga0466729_057120 | 3300042621 | Bacteria | 37274 |
| 93 | Ga0466706_106204 | 3300042599 | Bacteria | 73373 |
| 94 | Ga0466717_127092 | 3300042604 | Bacteria | 27566 |
| 95 | Ga0466716_166965 | 3300042605 | Bacteria | 15672 |
| 96 | Ga0123353_10192139 | 3300010167 | Bacteria | 3221 |
| 97 | Ga0466657_015947 | 3300042582 | Bacteria | 203876 |
| 98 | Ga0466735_093973 | 3300042624 | Bacteria | 1405 |
| 99 | Ga0466724_44619 | 3300042649 | Bacteria | 3819 |
| 100 | JGI24702J35022_10002623 | 3300002462 | Bacteria | 10914 |
| 101 | JGI24702J35022_10013246 | 3300002462 | Bacteria | 4569 |
| 102 | JGI24702J35022_10021860 | 3300002462 | Bacteria | 3467 |
| 103 | JGI24696J40584_12957043 | 3300002834 | Bacteria | 3330 |
| 104 | Ga0103264_1001892 | 3300007188 | Bacteria | 9300 |
| 105 | Ga0466705_211961 | 3300042612 | Bacteria | 3570 |
| 106 | Ga0466733_116961 | 3300042659 | Bacteria | 47513 |
| 107 | Ga0466723_347679 | 3300042618 | Bacteria | 27958 |
| 108 | Ga0466701_018796 | 3300042598 | Bacteria | 2713 |
| 109 | Ga0466706_032116 | 3300042599 | Unclassified | 3850 |
| 110 | Ga0466706_114300 | 3300042599 | Bacteria | 35982 |
| 111 | Ga0466714_062703 | 3300042603 | Bacteria | 39199 |
| 112 | Ga0466714_108254 | 3300042603 | Bacteria | 7701 |
| 113 | Ga0466717_114035 | 3300042604 | Bacteria | 9250 |
| 114 | Ga0123357_10047923 | 3300009784 | Bacteria | 5791 |
| 115 | Ga0123356_10050874 | 3300010049 | Bacteria | 3854 |
| 116 | Ga0123353_10098641 | 3300010167 | Bacteria | 4708 |
| 117 | Ga0123354_10000618 | 3300010882 | Bacteria | 37182 |
| 118 | Ga0466696_092398 | 3300042596 | Bacteria | 31103 |
| 119 | Ga0466696_430605 | 3300042596 | Bacteria | 2290 |
| 120 | Ga0466729_290832 | 3300042621 | Bacteria | 1490 |
| 121 | Ga0466704_349450 | 3300042643 | Bacteria | 6830 |
| 122 | HBC_ctgsDRAFT_1009450 | 3300000333 | Unclassified | 2318 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF03054 | tRNA_Me_trans | tRNA methyl transferase HUP domain | 61 | 262 | 0.97 |
| PF20258 | tRNA_Me_trans_C | Aminomethyltransferase beta-barrel domain | 378 | 451 | 0.96 |
| PF20259 | tRNA_Me_trans_M | tRNA methyl transferase PRC-barrel domain | 316 | 361 | 0.94 |
| PF00733 | Asn_synthase | Asparagine synthase | 62 | 413 | 0.7 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.