Protein Family IF07113
Metagenome
Isolate
151
Members
51
Samples
136
Scaffolds
256.74
Avg Length
Representative Sequence
- ID
- 3300042612|Ga0466705_146398|Ga0466705_146398_6311_7201
- Length
- 296 aa
- Sequence
- MIKTIAQTIAFSCMLMEINIGTSGIKTLGTNYTFWREKMGIIEKMRLDDKKTLVTGGARGIGYTIALALAEAGADVAIVDTDGETAQKSAEDIAAATGRRTLALKTDVTQKAGVDAMIADMLKAFGRIDAAFCNAGICMNIPAEEMSLEDWNKVITINLTGVFLTAQAAGKVMIRQGGGSIINTASMSAHIVNVPQPQCSYNASKAGVIQLTKSLAVEWALKKVRVNSISPGYIGTDLIQNSPALRPLIEQWNAMAPLKRLGRPDELQAIAVYLAGDSSAFTTGSDFVIDGAFTCI
Sample Types
Isolate
9.9%
Metagenome
90.1%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
27.5%
Termitidae
25.5%
Blattidae
19.6%
Unclassified
9.8%
Rhinotermitidae
5.9%
Termopsidae
5.9%
Passalidae
3.9%
Penaeidae
2.0%
Taxonomy
Archaea
0
Bacteria
143
Eukaryota
0
Viruses
0
Unclassified
8
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 2 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 3 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 4 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 5 | 2529293168 | Ruminiclostridium cellobioparum termitidis CT1112 | Isolate | Termitidae |
| 6 | 2940292506 | Lachnoclostridium sp. PH5-23 | Isolate | Blattidae |
| 7 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 8 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 9 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 10 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 11 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 12 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 13 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 14 | 2940280053 | Lachnospiraceae bacterium PF1-22 | Isolate | Blattidae |
| 15 | 2944625312 | Dysgonomonas sp. PF1-3 | Isolate | Blattidae |
| 16 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 17 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 18 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 19 | 2820951912 | Unclassified Acidobacteria Emb289P4bin26 | Isolate | Unclassified |
| 20 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 21 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 22 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 23 | 2940230426 | Lachnospiraceae bacterium PH5-48 | Isolate | Blattidae |
| 24 | 2940283334 | Lachnospiraceae bacterium PF1-4 | Isolate | Blattidae |
| 25 | 2940295490 | Lachnospiraceae bacterium PH1-22 | Isolate | Blattidae |
| 26 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 27 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 28 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 29 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 30 | 2820332331 | Unclassified Firmicutes Nt197P3bin75 | Isolate | Unclassified |
| 31 | 2940286528 | Lachnospiraceae bacterium PFB1-21 | Isolate | Blattidae |
| 32 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 33 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 34 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 35 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 36 | 650716102 | Treponema primitia ZAS-2 | Isolate | Unclassified |
| 37 | 8082023105 | Niallia sp. Man26 | Isolate | Penaeidae |
| 38 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 39 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 40 | 2940277027 | Lachnospiraceae bacterium PF1-21 | Isolate | Blattidae |
| 41 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 42 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 43 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 44 | 2940289514 | Lachnospiraceae bacterium PM6-15 | Isolate | Blattidae |
| 45 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 46 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 47 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 48 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 49 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 50 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 51 | 2940233634 | Lachnoclostridium sp. PF5-10 | Isolate | Blattidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466690_261637 | 3300042590 | Bacteria | 6133 |
| 2 | Ga0466690_388300 | 3300042590 | Bacteria | 1724 |
| 3 | Ga0466696_327143 | 3300042596 | Bacteria | 2860 |
| 4 | Ga0466716_294821 | 3300042605 | Bacteria | 7308 |
| 5 | Ga0466716_470934 | 3300042605 | Bacteria | 15520 |
| 6 | Ga0466722_027392 | 3300042609 | Bacteria | 6957 |
| 7 | Ga0466722_066230 | 3300042609 | Bacteria | 1171 |
| 8 | Ga0466722_104506 | 3300042609 | Bacteria | 4389 |
| 9 | Ga0466722_172058 | 3300042609 | Bacteria | 3524 |
| 10 | Ga0466715_501482 | 3300042616 | Bacteria | 4243 |
| 11 | Ga0123356_10908869 | 3300010049 | Bacteria | 1051 |
| 12 | Ga0123353_10323189 | 3300010167 | Bacteria | 2340 |
| 13 | Ga0123353_10851367 | 3300010167 | Bacteria | 1250 |
| 14 | Ga0466735_072160 | 3300042624 | Bacteria | 1893 |
| 15 | Ga0466735_115920 | 3300042624 | Bacteria | 8800 |
| 16 | Ga0466727_159880 | 3300042655 | Bacteria | 1019 |
| 17 | 2227080796 | 2225789004 | Bacteria | 41356 |
| 18 | IMNBL1DRAFT_c0001391 | 3300000062 | Bacteria | 18187 |
| 19 | JGI24702J35022_10102897 | 3300002462 | Bacteria | 1565 |
| 20 | Ga0466656_276204 | 3300042550 | Bacteria | 1223 |
| 21 | Ga0466690_105115 | 3300042590 | Bacteria | 1562 |
| 22 | Ga0466707_397639 | 3300042601 | Bacteria | 8798 |
| 23 | Ga0466719_561103 | 3300042606 | Bacteria | 2119 |
| 24 | Ga0466722_090546 | 3300042609 | Bacteria | 4833 |
| 25 | Ga0466722_220336 | 3300042609 | Bacteria | 5814 |
| 26 | Ga0466705_146398 | 3300042612 | Bacteria | 14014 |
| 27 | Ga0466711_131685 | 3300042615 | Bacteria | 23580 |
| 28 | Ga0466715_128287 | 3300042616 | Bacteria | 12480 |
| 29 | Ga0466715_172587 | 3300042616 | Unclassified | 4079 |
| 30 | Ga0123355_10178058 | 3300009826 | Bacteria | 3162 |
| 31 | Ga0123356_10000896 | 3300010049 | Bacteria | 32939 |
| 32 | Ga0123356_10182259 | 3300010049 | Bacteria | 2123 |
| 33 | Ga0123353_10393665 | 3300010167 | Bacteria | 2066 |
| 34 | Ga0466703_075136 | 3300042636 | Bacteria | 6705 |
| 35 | Ga0466704_026607 | 3300042643 | Bacteria | 1682 |
| 36 | Ga0466704_051831 | 3300042643 | Bacteria | 6756 |
| 37 | Ga0466724_66455 | 3300042649 | Bacteria | 1781 |
| 38 | Ga0466708_143915 | 3300042652 | Bacteria | 6385 |
| 39 | Ga0466727_324103 | 3300042655 | Bacteria | 10514 |
| 40 | Ga0466690_221812 | 3300042590 | Unclassified | 1349 |
| 41 | Ga0466707_312162 | 3300042601 | Bacteria | 2185 |
| 42 | Ga0466713_067214 | 3300042602 | Bacteria | 19076 |
| 43 | Ga0466716_462024 | 3300042605 | Bacteria | 9069 |
| 44 | Ga0466705_082747 | 3300042612 | Bacteria | 9066 |
| 45 | Ga0466705_516535 | 3300042612 | Bacteria | 1915 |
| 46 | Ga0466711_205840 | 3300042615 | Bacteria | 1498 |
| 47 | Ga0466711_450331 | 3300042615 | Bacteria | 6529 |
| 48 | Ga0466723_032419 | 3300042618 | Bacteria | 2833 |
| 49 | Ga0466726_179551 | 3300042619 | Bacteria | 1359 |
| 50 | Ga0466726_296028 | 3300042619 | Bacteria | 1226 |
| 51 | Ga0466728_156664 | 3300042620 | Bacteria | 2457 |
| 52 | Ga0123356_10151129 | 3300010049 | Bacteria | 2305 |
| 53 | Ga0466731_027736 | 3300042622 | Bacteria | 1482 |
| 54 | Ga0466703_259873 | 3300042636 | Bacteria | 8541 |
| 55 | Ga0466703_264323 | 3300042636 | Bacteria | 1111 |
| 56 | Ga0466704_083254 | 3300042643 | Bacteria | 2463 |
| 57 | Ga0466704_125093 | 3300042643 | Bacteria | 12596 |
| 58 | Ga0466708_170909 | 3300042652 | Bacteria | 55846 |
| 59 | Ga0466708_195641 | 3300042652 | Bacteria | 1511 |
| 60 | Ga0466708_236913 | 3300042652 | Bacteria | 1731 |
| 61 | Ga0466708_339144 | 3300042652 | Bacteria | 2810 |
| 62 | Ga0466725_426949 | 3300042654 | Bacteria | 2565 |
| 63 | Ga0466701_052188 | 3300042598 | Bacteria | 1617 |
| 64 | Ga0466716_047375 | 3300042605 | Bacteria | 16790 |
| 65 | Ga0466723_038427 | 3300042618 | Bacteria | 2362 |
| 66 | Ga0466723_150254 | 3300042618 | Bacteria | 4827 |
| 67 | Ga0466723_268486 | 3300042618 | Bacteria | 6452 |
| 68 | Ga0466726_184995 | 3300042619 | Bacteria | 12877 |
| 69 | Ga0466728_019213 | 3300042620 | Bacteria | 2599 |
| 70 | Ga0123355_10642681 | 3300009826 | Bacteria | 1241 |
| 71 | Ga0123353_11032190 | 3300010167 | Bacteria | 1101 |
| 72 | Ga0466703_176327 | 3300042636 | Bacteria | 10615 |
| 73 | Ga0466704_002246 | 3300042643 | Unclassified | 6650 |
| 74 | Ga0466709_061667 | 3300042648 | Bacteria | 4860 |
| 75 | Ga0466708_055671 | 3300042652 | Bacteria | 8987 |
| 76 | Ga0466708_418480 | 3300042652 | Bacteria | 4344 |
| 77 | Ga0466727_023768 | 3300042655 | Bacteria | 6481 |
| 78 | Ga0466727_213751 | 3300042655 | Bacteria | 1909 |
| 79 | Ga0466707_304624 | 3300042601 | Bacteria | 2473 |
| 80 | Ga0466713_147787 | 3300042602 | Bacteria | 1374 |
| 81 | Ga0466719_055778 | 3300042606 | Bacteria | 11497 |
| 82 | Ga0466719_183437 | 3300042606 | Bacteria | 10750 |
| 83 | Ga0466722_018803 | 3300042609 | Bacteria | 3643 |
| 84 | Ga0466722_087815 | 3300042609 | Bacteria | 1962 |
| 85 | Ga0466705_110822 | 3300042612 | Bacteria | 5865 |
| 86 | Ga0466711_441473 | 3300042615 | Bacteria | 41991 |
| 87 | Ga0466715_011382 | 3300042616 | Bacteria | 12248 |
| 88 | Ga0466726_282159 | 3300042619 | Bacteria | 1155 |
| 89 | Ga0466728_230349 | 3300042620 | Bacteria | 10810 |
| 90 | Ga0466728_413874 | 3300042620 | Bacteria | 1699 |
| 91 | Ga0123356_10696435 | 3300010049 | Bacteria | 1185 |
| 92 | Ga0466727_265750 | 3300042655 | Bacteria | 36805 |
| 93 | Ga0466692_114726 | 3300042591 | Unclassified | 7993 |
| 94 | Ga0466693_209989 | 3300042592 | Bacteria | 1417 |
| 95 | Ga0466696_119011 | 3300042596 | Bacteria | 3102 |
| 96 | Ga0466719_049577 | 3300042606 | Bacteria | 18486 |
| 97 | Ga0466722_021401 | 3300042609 | Bacteria | 2075 |
| 98 | Ga0466705_059286 | 3300042612 | Bacteria | 1851 |
| 99 | Ga0466705_110771 | 3300042612 | Bacteria | 7742 |
| 100 | Ga0466715_122371 | 3300042616 | Bacteria | 7592 |
| 101 | Ga0466715_476366 | 3300042616 | Bacteria | 5243 |
| 102 | Ga0466728_434391 | 3300042620 | Bacteria | 1440 |
| 103 | Ga0123357_10014646 | 3300009784 | Bacteria | 10244 |
| 104 | Ga0123357_10420900 | 3300009784 | Bacteria | 1192 |
| 105 | Ga0123357_10447888 | 3300009784 | Bacteria | 1123 |
| 106 | Ga0466708_082191 | 3300042652 | Bacteria | 3804 |
| 107 | Ga0466727_170924 | 3300042655 | Bacteria | 1780 |
| 108 | Ga0123357_10000611 | 3300009784 | Bacteria | 35432 |
| 109 | Ga0466696_077730 | 3300042596 | Bacteria | 3911 |
| 110 | Ga0466713_126431 | 3300042602 | Bacteria | 15408 |
| 111 | Ga0466715_139361 | 3300042616 | Bacteria | 13505 |
| 112 | Ga0466726_269031 | 3300042619 | Bacteria | 10695 |
| 113 | Ga0466728_233143 | 3300042620 | Bacteria | 4580 |
| 114 | Ga0466733_075052 | 3300042659 | Bacteria | 2120 |
| 115 | Ga0466733_194712 | 3300042659 | Bacteria | 1385 |
| 116 | Ga0123357_10136766 | 3300009784 | Bacteria | 3027 |
| 117 | Ga0123355_10735780 | 3300009826 | Bacteria | 1120 |
| 118 | Ga0466735_013149 | 3300042624 | Bacteria | 8529 |
| 119 | Ga0466704_350964 | 3300042643 | Bacteria | 1696 |
| 120 | Ga0456237_0017736 | 3300041968 | Bacteria | 997 |
| 121 | Ga0466691_179970 | 3300042593 | Bacteria | 1591 |
| 122 | Ga0466691_181172 | 3300042593 | Bacteria | 5046 |
| 123 | Ga0466696_188930 | 3300042596 | Bacteria | 8331 |
| 124 | Ga0466707_159515 | 3300042601 | Bacteria | 1749 |
| 125 | Ga0466716_135027 | 3300042605 | Bacteria | 10267 |
| 126 | Ga0466719_202741 | 3300042606 | Unclassified | 1094 |
| 127 | Ga0466705_495146 | 3300042612 | Bacteria | 1297 |
| 128 | Ga0466711_089119 | 3300042615 | Bacteria | 5980 |
| 129 | Ga0466711_159149 | 3300042615 | Bacteria | 29015 |
| 130 | Ga0466726_482695 | 3300042619 | Bacteria | 2569 |
| 131 | Ga0123355_10002078 | 3300009826 | Unclassified | 28247 |
| 132 | Ga0123355_10667501 | 3300009826 | Bacteria | 1207 |
| 133 | Ga0123356_10286761 | 3300010049 | Unclassified | 1745 |
| 134 | Ga0466703_177815 | 3300042636 | Bacteria | 53686 |
| 135 | Ga0466709_136674 | 3300042648 | Unclassified | 4154 |
| 136 | Ga0466727_317928 | 3300042655 | Bacteria | 2723 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.