Protein Family IF07104
Metagenome
Metatranscriptome
Isolate
203
Members
59
Samples
195
Scaffolds
132.38
Avg Length
Representative Sequence
- ID
- 3300042612|Ga0466705_124174|Ga0466705_124174_5840_6301
- Length
- 153 aa
- Sequence
- MRKLTYLAVFEADENPGISVYFPDVPGCVSCGDNFDHALQMAKEALSLHIYGMEKDGEPPPHRTDKIPETGPGDMVVPVSIYPDMVKDEINNRREKTTVTIPRWLKEAAEAEGINYSRLLETAIKETLGGPRPIKKSYKICGFKKGQTDGLPG
Sample Types
Isolate
3.9%
Metagenome
95.6%
MAG
0.0%
Metatranscriptome
0.5%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
41.1%
Kalotermitidae
25.0%
Unclassified
17.9%
Rhinotermitidae
7.1%
Termopsidae
5.4%
Cryptocercidae
1.8%
Hodotermitidae
1.8%
Taxonomy
Archaea
1
Bacteria
180
Eukaryota
0
Viruses
0
Unclassified
22
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125694 | Treponema sp. Th196P3bin120 | Isolate | Unclassified |
| 2 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 3 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 4 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 5 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 6 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 7 | 2781125681 | Treponema sp. Lab288P1bin11 | Isolate | Unclassified |
| 8 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 9 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 10 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 11 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 12 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 13 | 2781125635 | Treponema sp. Co191P1bin60 | Isolate | Unclassified |
| 14 | 2781125640 | Treponema sp. Co191P1bin37 | Isolate | Unclassified |
| 15 | 2819998259 | Unclassified Spirochaetes Nc150P4bin23 | Isolate | Unclassified |
| 16 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 17 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 18 | 2781125683 | Treponema sp. Lab288P1bin34 | Isolate | Unclassified |
| 19 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 20 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 21 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 22 | 3300010053 | Insect gut microbial communities from Cryptocercus cockroaches from Viginia, USA | Metagenome | Cryptocercidae |
| 23 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 24 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 25 | 3300021190 | Termite gut microbial communities from nest - French Guiana - 1_3 mRNA 1_3 mRNA SA | Metatranscriptome | Termitidae |
| 26 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 27 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 28 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 29 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 30 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 31 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 32 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 33 | 2781125650 | Treponema sp. Co191P3bin64 | Isolate | Unclassified |
| 34 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 35 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 36 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 37 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 38 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 39 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 40 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 41 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 42 | 2781125645 | Treponema sp. Co191P3bin32 | Isolate | Unclassified |
| 43 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 44 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 45 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 46 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 47 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 48 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 49 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 50 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 51 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 52 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 53 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 54 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 55 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 56 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 57 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 58 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 59 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_004007 | 3300042612 | Bacteria | 5470 |
| 2 | AustNasuHG_c1006663 | 3300000089 | Bacteria | 4115 |
| 3 | JGI24698J34947_10033273 | 3300002449 | Bacteria | 2705 |
| 4 | JGI24695J34938_10000091 | 3300002450 | Bacteria | 79625 |
| 5 | JGI24695J34938_10000229 | 3300002450 | Bacteria | 53063 |
| 6 | JGI24695J34938_10006952 | 3300002450 | Unclassified | 6714 |
| 7 | JGI24695J34938_10034238 | 3300002450 | Bacteria | 2331 |
| 8 | Ga0068302_10230304 | 3300005071 | Bacteria | 2519 |
| 9 | Ga0466693_303990 | 3300042592 | Bacteria | 31686 |
| 10 | Ga0466691_094562 | 3300042593 | Bacteria | 3630 |
| 11 | Ga0466694_314691 | 3300042594 | Bacteria | 4143 |
| 12 | Ga0466694_408467 | 3300042594 | Bacteria | 1787 |
| 13 | Ga0466699_199447 | 3300042597 | Bacteria | 1225 |
| 14 | Ga0466715_061642 | 3300042616 | Bacteria | 1188 |
| 15 | Ga0466715_072850 | 3300042616 | Bacteria | 10551 |
| 16 | Ga0466715_090872 | 3300042616 | Bacteria | 1719 |
| 17 | Ga0466718_138198 | 3300042617 | Bacteria | 1022 |
| 18 | Ga0466728_132558 | 3300042620 | Bacteria | 3302 |
| 19 | Ga0466728_168833 | 3300042620 | Bacteria | 4223 |
| 20 | Ga0466728_195192 | 3300042620 | Bacteria | 1058 |
| 21 | Ga0466728_345555 | 3300042620 | Bacteria | 4743 |
| 22 | Ga0466731_190022 | 3300042622 | Bacteria | 1205 |
| 23 | Ga0466734_086055 | 3300042623 | Bacteria | 2211 |
| 24 | Ga0466703_097736 | 3300042636 | Unclassified | 1074 |
| 25 | Ga0466708_045011 | 3300042652 | Bacteria | 11762 |
| 26 | Ga0466700_219889 | 3300042600 | Bacteria | 22737 |
| 27 | Ga0466707_049208 | 3300042601 | Bacteria | 1403 |
| 28 | Ga0466707_376357 | 3300042601 | Unclassified | 1209 |
| 29 | Ga0466720_107437 | 3300042607 | Unclassified | 7772 |
| 30 | Ga0466705_043203 | 3300042612 | Bacteria | 10594 |
| 31 | AustNasuHG_c1008956 | 3300000089 | Bacteria | 3535 |
| 32 | JGI24695J34938_10000556 | 3300002450 | Bacteria | 36040 |
| 33 | JGI24695J34938_10011561 | 3300002450 | Bacteria | 4747 |
| 34 | Ga0072940_1069012 | 3300005200 | Bacteria | 1406 |
| 35 | Ga0072941_1046865 | 3300005201 | Bacteria | 3029 |
| 36 | Ga0222431_1100203 | 3300021190 | Bacteria | 764 |
| 37 | Ga0264413_130858 | 3300024493 | Unclassified | 1086 |
| 38 | Ga0466690_376155 | 3300042590 | Bacteria | 2386 |
| 39 | Ga0466691_147948 | 3300042593 | Bacteria | 4991 |
| 40 | Ga0466696_382068 | 3300042596 | Bacteria | 3326 |
| 41 | Ga0466699_266799 | 3300042597 | Bacteria | 3200 |
| 42 | Ga0466726_024382 | 3300042619 | Bacteria | 1740 |
| 43 | Ga0466726_279831 | 3300042619 | Unclassified | 1163 |
| 44 | Ga0466729_109741 | 3300042621 | Bacteria | 2077 |
| 45 | Ga0466703_027500 | 3300042636 | Unclassified | 1534 |
| 46 | Ga0466703_039077 | 3300042636 | Bacteria | 17860 |
| 47 | Ga0466703_174625 | 3300042636 | Bacteria | 1055 |
| 48 | Ga0466708_073652 | 3300042652 | Bacteria | 1112 |
| 49 | Ga0466727_343141 | 3300042655 | Bacteria | 1107 |
| 50 | Ga0466717_027861 | 3300042604 | Bacteria | 1136 |
| 51 | Ga0466716_043537 | 3300042605 | Bacteria | 14034 |
| 52 | Ga0466719_327721 | 3300042606 | Bacteria | 3392 |
| 53 | Ga0466720_136013 | 3300042607 | Bacteria | 5373 |
| 54 | Ga0466722_091876 | 3300042609 | Bacteria | 2093 |
| 55 | Ga0466698_494862 | 3300042610 | Bacteria | 1296 |
| 56 | JGI24698J34947_10010848 | 3300002449 | Bacteria | 4999 |
| 57 | JGI24695J34938_10078010 | 3300002450 | Bacteria | 1372 |
| 58 | JGI24695J34938_10313400 | 3300002450 | Bacteria | 681 |
| 59 | JGI24705J35276_11838960 | 3300002504 | Unclassified | 708 |
| 60 | Ga0072940_1025209 | 3300005200 | Bacteria | 2496 |
| 61 | Ga0072940_1332583 | 3300005200 | Bacteria | 2221 |
| 62 | Ga0123354_10837118 | 3300010882 | Bacteria | 613 |
| 63 | Ga0265387_1003540 | 3300024582 | Bacteria | 2151 |
| 64 | Ga0466690_094360 | 3300042590 | Bacteria | 2136 |
| 65 | Ga0466696_191242 | 3300042596 | Bacteria | 11182 |
| 66 | Ga0466699_017757 | 3300042597 | Bacteria | 14714 |
| 67 | Ga0466705_450887 | 3300042612 | Bacteria | 9820 |
| 68 | Ga0466731_138399 | 3300042622 | Bacteria | 2573 |
| 69 | Ga0466703_065724 | 3300042636 | Bacteria | 5680 |
| 70 | Ga0466703_069246 | 3300042636 | Bacteria | 5852 |
| 71 | Ga0466703_403834 | 3300042636 | Bacteria | 2529 |
| 72 | Ga0466704_244798 | 3300042643 | Unclassified | 2649 |
| 73 | Ga0466704_412157 | 3300042643 | Unclassified | 13012 |
| 74 | Ga0466704_563554 | 3300042643 | Bacteria | 1219 |
| 75 | Ga0466709_023012 | 3300042648 | Bacteria | 7872 |
| 76 | Ga0466706_273234 | 3300042599 | Unclassified | 2761 |
| 77 | Ga0466722_009089 | 3300042609 | Bacteria | 5060 |
| 78 | Ga0466722_075288 | 3300042609 | Bacteria | 3987 |
| 79 | Ga0466722_161970 | 3300042609 | Bacteria | 3891 |
| 80 | Ga0466705_082723 | 3300042612 | Bacteria | 3408 |
| 81 | Ga0466705_329427 | 3300042612 | Bacteria | 2313 |
| 82 | Ga0466732_200420 | 3300042656 | Bacteria | 2373 |
| 83 | AustNasuHG_c1003532 | 3300000089 | Bacteria | 5647 |
| 84 | Ga0123355_10231919 | 3300009826 | Bacteria | 2634 |
| 85 | Ga0123356_10233727 | 3300010049 | Bacteria | 1904 |
| 86 | Ga0123353_10593570 | 3300010167 | Bacteria | 1585 |
| 87 | Ga0123353_11377458 | 3300010167 | Bacteria | 909 |
| 88 | Ga0123354_10657259 | 3300010882 | Bacteria | 746 |
| 89 | Ga0264413_100204 | 3300024493 | Bacteria | 3402 |
| 90 | Ga0264413_154158 | 3300024493 | Unclassified | 2743 |
| 91 | Ga0415639_037162 | 3300038395 | Bacteria | 1584 |
| 92 | Ga0456237_0011828 | 3300041968 | Bacteria | 1270 |
| 93 | Ga0466691_025179 | 3300042593 | Bacteria | 1689 |
| 94 | Ga0466705_530000 | 3300042612 | Bacteria | 3333 |
| 95 | Ga0466712_309917 | 3300042614 | Bacteria | 2072 |
| 96 | Ga0466726_225589 | 3300042619 | Bacteria | 1646 |
| 97 | Ga0466728_060664 | 3300042620 | Bacteria | 1892 |
| 98 | Ga0466728_092811 | 3300042620 | Bacteria | 3849 |
| 99 | Ga0466729_293486 | 3300042621 | Bacteria | 4006 |
| 100 | Ga0466703_175702 | 3300042636 | Bacteria | 2517 |
| 101 | Ga0466703_332708 | 3300042636 | Bacteria | 2586 |
| 102 | Ga0466704_333550 | 3300042643 | Unclassified | 1794 |
| 103 | Ga0466704_361962 | 3300042643 | Bacteria | 1704 |
| 104 | Ga0466704_553461 | 3300042643 | Bacteria | 1766 |
| 105 | Ga0466709_042681 | 3300042648 | Bacteria | 1967 |
| 106 | Ga0466716_295885 | 3300042605 | Bacteria | 2457 |
| 107 | Ga0466719_024784 | 3300042606 | Bacteria | 7261 |
| 108 | Ga0466719_293719 | 3300042606 | Bacteria | 1043 |
| 109 | Ga0466722_150030 | 3300042609 | Bacteria | 1868 |
| 110 | Ga0466722_168819 | 3300042609 | Bacteria | 4030 |
| 111 | Ga0466705_011736 | 3300042612 | Bacteria | 6433 |
| 112 | Ga0466732_289977 | 3300042656 | Bacteria | 2384 |
| 113 | JGI24695J34938_10001531 | 3300002450 | Bacteria | 19506 |
| 114 | JGI24695J34938_10004828 | 3300002450 | Bacteria | 8666 |
| 115 | JGI24695J34938_10107150 | 3300002450 | Bacteria | 1140 |
| 116 | Ga0123355_10844358 | 3300009826 | Bacteria | 1009 |
| 117 | Ga0134290_1272533 | 3300010053 | Bacteria | 554 |
| 118 | Ga0466691_056101 | 3300042593 | Bacteria | 4632 |
| 119 | Ga0466699_417217 | 3300042597 | Unclassified | 1122 |
| 120 | Ga0466711_019024 | 3300042615 | Bacteria | 5328 |
| 121 | Ga0466718_122235 | 3300042617 | Unclassified | 1525 |
| 122 | Ga0466723_075222 | 3300042618 | Bacteria | 1066 |
| 123 | Ga0466723_137449 | 3300042618 | Unclassified | 3551 |
| 124 | Ga0466728_137979 | 3300042620 | Bacteria | 2621 |
| 125 | Ga0466731_410703 | 3300042622 | Bacteria | 1365 |
| 126 | Ga0466703_318804 | 3300042636 | Bacteria | 3704 |
| 127 | Ga0466704_116061 | 3300042643 | Bacteria | 12372 |
| 128 | Ga0466708_136350 | 3300042652 | Bacteria | 28309 |
| 129 | Ga0466727_057629 | 3300042655 | Bacteria | 2793 |
| 130 | Ga0466706_221493 | 3300042599 | Bacteria | 1742 |
| 131 | Ga0466719_039456 | 3300042606 | Bacteria | 1004 |
| 132 | Ga0466722_055128 | 3300042609 | Bacteria | 1653 |
| 133 | Ga0466705_124174 | 3300042612 | Bacteria | 7229 |
| 134 | JGI24698J34947_10003509 | 3300002449 | Bacteria | 8517 |
| 135 | JGI24695J34938_10004753 | 3300002450 | Unclassified | 8782 |
| 136 | Ga0123355_10337912 | 3300009826 | Bacteria | 2010 |
| 137 | Ga0123355_10420481 | 3300009826 | Bacteria | 1708 |
| 138 | Ga0123356_11025051 | 3300010049 | Bacteria | 995 |
| 139 | Ga0264413_102834 | 3300024493 | Bacteria | 2927 |
| 140 | Ga0466690_022678 | 3300042590 | Bacteria | 3831 |
| 141 | Ga0466690_246089 | 3300042590 | Bacteria | 2017 |
| 142 | Ga0466692_006142 | 3300042591 | Bacteria | 33152 |
| 143 | Ga0466691_036488 | 3300042593 | Bacteria | 4196 |
| 144 | Ga0466691_118494 | 3300042593 | Bacteria | 7101 |
| 145 | Ga0466694_144117 | 3300042594 | Bacteria | 3065 |
| 146 | Ga0466694_377357 | 3300042594 | Bacteria | 1041 |
| 147 | Ga0466694_406132 | 3300042594 | Bacteria | 1029 |
| 148 | Ga0466715_188998 | 3300042616 | Bacteria | 1054 |
| 149 | Ga0466726_311771 | 3300042619 | Bacteria | 1395 |
| 150 | Ga0466728_043633 | 3300042620 | Bacteria | 3722 |
| 151 | Ga0466731_017534 | 3300042622 | Bacteria | 6342 |
| 152 | Ga0466704_141943 | 3300042643 | Bacteria | 51616 |
| 153 | Ga0466704_200416 | 3300042643 | Bacteria | 5986 |
| 154 | Ga0466716_474623 | 3300042605 | Unclassified | 2086 |
| 155 | Ga0466719_312538 | 3300042606 | Bacteria | 1132 |
| 156 | Ga0466722_064023 | 3300042609 | Bacteria | 1771 |
| 157 | Ga0466722_068715 | 3300042609 | Bacteria | 1036 |
| 158 | Ga0466732_137115 | 3300042656 | Bacteria | 1499 |
| 159 | JGI24698J34947_10027471 | 3300002449 | Bacteria | 3019 |
| 160 | Ga0415639_185154 | 3300038395 | Bacteria | 1008 |
| 161 | Ga0456237_0012615 | 3300041968 | Bacteria | 1221 |
| 162 | Ga0466692_060161 | 3300042591 | Bacteria | 1590 |
| 163 | Ga0466692_087456 | 3300042591 | Bacteria | 9686 |
| 164 | Ga0466692_159372 | 3300042591 | Bacteria | 1215 |
| 165 | Ga0466696_016859 | 3300042596 | Bacteria | 2395 |
| 166 | Ga0466715_197441 | 3300042616 | Bacteria | 3340 |
| 167 | Ga0466718_023311 | 3300042617 | Bacteria | 8933 |
| 168 | Ga0466723_028404 | 3300042618 | Bacteria | 4751 |
| 169 | Ga0466723_229569 | 3300042618 | Bacteria | 135891 |
| 170 | Ga0466703_190612 | 3300042636 | Archaea | 1325 |
| 171 | Ga0466704_045142 | 3300042643 | Bacteria | 4097 |
| 172 | Ga0466704_076254 | 3300042643 | Unclassified | 3690 |
| 173 | Ga0466708_225749 | 3300042652 | Bacteria | 2481 |
| 174 | Ga0466706_057595 | 3300042599 | Bacteria | 1205 |
| 175 | Ga0466700_172537 | 3300042600 | Bacteria | 2380 |
| 176 | Ga0466707_383380 | 3300042601 | Bacteria | 5143 |
| 177 | Ga0466713_132756 | 3300042602 | Bacteria | 1097 |
| 178 | Ga0466719_300412 | 3300042606 | Bacteria | 1210 |
| 179 | Ga0466698_459821 | 3300042610 | Bacteria | 1719 |
| 180 | Ga0466732_185257 | 3300042656 | Bacteria | 7874 |
| 181 | Ga0123354_10816396 | 3300010882 | Bacteria | 625 |
| 182 | Ga0415639_060040 | 3300038395 | Bacteria | 1198 |
| 183 | Ga0466692_092996 | 3300042591 | Unclassified | 1427 |
| 184 | Ga0466692_179780 | 3300042591 | Bacteria | 5370 |
| 185 | Ga0466705_495059 | 3300042612 | Bacteria | 2791 |
| 186 | Ga0466712_169423 | 3300042614 | Bacteria | 10051 |
| 187 | Ga0466728_051765 | 3300042620 | Bacteria | 2520 |
| 188 | Ga0466704_361557 | 3300042643 | Unclassified | 2126 |
| 189 | Ga0466708_356224 | 3300042652 | Bacteria | 1260 |
| 190 | Ga0466727_275177 | 3300042655 | Bacteria | 1575 |
| 191 | Ga0466707_080355 | 3300042601 | Bacteria | 1012 |
| 192 | Ga0466719_054680 | 3300042606 | Unclassified | 1122 |
| 193 | Ga0466720_151386 | 3300042607 | Bacteria | 10034 |
| 194 | Ga0466722_166214 | 3300042609 | Bacteria | 4835 |
| 195 | Ga0466698_206363 | 3300042610 | Bacteria | 2074 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF15919 | HicB_lk_antitox | HicB_like antitoxin of bacterial toxin-antitoxin system | 6 | 105 | 0.74 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.