Protein Family IF07090
Metagenome
Isolate
244
Members
56
Samples
236
Scaffolds
220.16
Avg Length
Representative Sequence
- ID
- 3300042612|Ga0466705_096765|Ga0466705_096765_2353_3141
- Length
- 262 aa
- Sequence
- MGQDLFPEKKLSGCRRETDPVSGIPAGSIRKSMKILCVSDQIDPLVYTNSIRERFKDVDLILSAGDVPMDYLDFIVSSLNKPLLYIAGNHHTKTPGGGRTFMGQFAESKEDDSFGACYADSKVCLEEGLLVAGLGGSMRYNQGENQFTDFQMYKRILKMLPGLIFNRIFRGRFVDVLLTHASPRGIHDREDKCHQGFKAFLWFMRVFKPRYLIHGHIHLYDLSEVRTTQYHKTLVINAFNHYVIDTEILVPLQEEKTESGSS
Sample Types
Isolate
3.3%
Metagenome
96.7%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
41.8%
Kalotermitidae
25.5%
Unclassified
16.4%
Termopsidae
7.3%
Rhinotermitidae
5.5%
Hodotermitidae
1.8%
Blaberidae
1.8%
Taxonomy
Archaea
1
Bacteria
234
Eukaryota
0
Viruses
0
Unclassified
9
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125629 | Treponema sp. Nt197P3bin20 | Isolate | Unclassified |
| 2 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 3 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 4 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 5 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 6 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 7 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 8 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 9 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 10 | 2781125630 | Treponema sp. Nt197P3bin60 | Isolate | Unclassified |
| 11 | 2781125693 | Treponema sp. Th196P3bin148 | Isolate | Unclassified |
| 12 | 2781125697 | Treponema sp. Th196P4bin17 | Isolate | Unclassified |
| 13 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 14 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 15 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 16 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 17 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 18 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 19 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 20 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 21 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 22 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 23 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 24 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 25 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 26 | 2781125666 | Treponema sp. Emb289P4bin7 | Isolate | Unclassified |
| 27 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 28 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 29 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 30 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 31 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 32 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 33 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 34 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 35 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 36 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 37 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 38 | 2781125656 | Treponema sp. Emb289P1bin65 | Isolate | Unclassified |
| 39 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 40 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 41 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 42 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 43 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 44 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 45 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 46 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 47 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 48 | 2772190975 | Treponema sp. RmG30 | Isolate | Blaberidae |
| 49 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 50 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 51 | 2781125690 | Treponema sp. Th196P3bin63 | Isolate | Unclassified |
| 52 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 53 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 54 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 55 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 56 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466733_081933 | 3300042659 | Bacteria | 4821 |
| 2 | Ga0466715_299003 | 3300042616 | Bacteria | 25946 |
| 3 | Ga0466715_332016 | 3300042616 | Bacteria | 3396 |
| 4 | Ga0466723_322369 | 3300042618 | Bacteria | 6851 |
| 5 | Ga0466726_192963 | 3300042619 | Bacteria | 8501 |
| 6 | Ga0466726_223026 | 3300042619 | Bacteria | 1907 |
| 7 | Ga0123353_10377464 | 3300010167 | Bacteria | 2122 |
| 8 | Ga0264413_131996 | 3300024493 | Bacteria | 3008 |
| 9 | Ga0264413_138558 | 3300024493 | Bacteria | 2251 |
| 10 | Ga0415639_032816 | 3300038395 | Bacteria | 3473 |
| 11 | Ga0456237_0003013 | 3300041968 | Bacteria | 2742 |
| 12 | Ga0466692_053556 | 3300042591 | Bacteria | 1549 |
| 13 | Ga0466691_099842 | 3300042593 | Bacteria | 23679 |
| 14 | Ga0466699_167698 | 3300042597 | Bacteria | 1992 |
| 15 | Ga0466699_279376 | 3300042597 | Bacteria | 1968 |
| 16 | Ga0466699_346302 | 3300042597 | Bacteria | 2278 |
| 17 | Ga0466699_398838 | 3300042597 | Bacteria | 1596 |
| 18 | Ga0466707_046409 | 3300042601 | Unclassified | 5484 |
| 19 | Ga0466716_067920 | 3300042605 | Bacteria | 5619 |
| 20 | Ga0466719_181726 | 3300042606 | Bacteria | 3156 |
| 21 | Ga0466719_244097 | 3300042606 | Bacteria | 1522 |
| 22 | Ga0466719_245339 | 3300042606 | Bacteria | 2805 |
| 23 | Ga0466719_412649 | 3300042606 | Bacteria | 9439 |
| 24 | Ga0466719_437305 | 3300042606 | Bacteria | 16263 |
| 25 | Ga0466720_012952 | 3300042607 | Bacteria | 3255 |
| 26 | JGI24695J34938_10022633 | 3300002450 | Bacteria | 3047 |
| 27 | JGI24702J35022_10002838 | 3300002462 | Bacteria | 10497 |
| 28 | Ga0466704_377925 | 3300042643 | Bacteria | 1488 |
| 29 | Ga0466708_230620 | 3300042652 | Bacteria | 9141 |
| 30 | Ga0466727_191718 | 3300042655 | Bacteria | 10335 |
| 31 | Ga0466705_033852 | 3300042612 | Bacteria | 4588 |
| 32 | Ga0466705_096765 | 3300042612 | Bacteria | 6374 |
| 33 | Ga0466705_332832 | 3300042612 | Bacteria | 12862 |
| 34 | Ga0466733_029235 | 3300042659 | Bacteria | 1135 |
| 35 | Ga0466705_401681 | 3300042612 | Bacteria | 11649 |
| 36 | Ga0466712_125376 | 3300042614 | Bacteria | 1149 |
| 37 | Ga0466712_223887 | 3300042614 | Bacteria | 2756 |
| 38 | Ga0466715_063016 | 3300042616 | Bacteria | 18862 |
| 39 | Ga0466715_081987 | 3300042616 | Bacteria | 10360 |
| 40 | Ga0466715_359581 | 3300042616 | Bacteria | 3226 |
| 41 | Ga0466723_075373 | 3300042618 | Bacteria | 14423 |
| 42 | Ga0466728_243341 | 3300042620 | Bacteria | 7548 |
| 43 | Ga0123357_10146541 | 3300009784 | Bacteria | 2881 |
| 44 | Ga0123355_10088911 | 3300009826 | Bacteria | 4904 |
| 45 | Ga0466693_324531 | 3300042592 | Bacteria | 1507 |
| 46 | Ga0466691_064605 | 3300042593 | Bacteria | 47054 |
| 47 | Ga0466694_407771 | 3300042594 | Bacteria | 3740 |
| 48 | Ga0466696_151398 | 3300042596 | Bacteria | 77060 |
| 49 | Ga0466699_338763 | 3300042597 | Bacteria | 1234 |
| 50 | Ga0466706_153781 | 3300042599 | Bacteria | 2206 |
| 51 | Ga0466700_160299 | 3300042600 | Bacteria | 1348 |
| 52 | Ga0466700_282991 | 3300042600 | Bacteria | 4420 |
| 53 | Ga0466720_085862 | 3300042607 | Bacteria | 25090 |
| 54 | Ga0466698_504584 | 3300042610 | Bacteria | 1663 |
| 55 | JGI24698J34947_10014021 | 3300002449 | Unclassified | 4368 |
| 56 | Ga0466735_128181 | 3300042624 | Bacteria | 2450 |
| 57 | Ga0466735_228118 | 3300042624 | Bacteria | 3237 |
| 58 | Ga0466704_186349 | 3300042643 | Bacteria | 3616 |
| 59 | Ga0466709_211066 | 3300042648 | Bacteria | 2244 |
| 60 | Ga0466727_341756 | 3300042655 | Bacteria | 2911 |
| 61 | Ga0466733_157511 | 3300042659 | Bacteria | 1676 |
| 62 | Ga0466715_208945 | 3300042616 | Bacteria | 14874 |
| 63 | Ga0466726_192781 | 3300042619 | Bacteria | 2371 |
| 64 | Ga0466726_333465 | 3300042619 | Bacteria | 3694 |
| 65 | Ga0466726_451497 | 3300042619 | Bacteria | 2388 |
| 66 | Ga0123353_10120005 | 3300010167 | Bacteria | 4228 |
| 67 | Ga0123353_10188452 | 3300010167 | Bacteria | 3259 |
| 68 | Ga0466690_262544 | 3300042590 | Bacteria | 3937 |
| 69 | Ga0466691_042556 | 3300042593 | Bacteria | 6787 |
| 70 | Ga0466691_133010 | 3300042593 | Bacteria | 10039 |
| 71 | Ga0466691_217645 | 3300042593 | Bacteria | 7188 |
| 72 | Ga0466696_403676 | 3300042596 | Bacteria | 1231 |
| 73 | Ga0466699_068459 | 3300042597 | Bacteria | 23612 |
| 74 | Ga0466719_249516 | 3300042606 | Bacteria | 2993 |
| 75 | Ga0466719_285210 | 3300042606 | Bacteria | 1884 |
| 76 | AustNasuHG_c1031747 | 3300000089 | Bacteria | 1484 |
| 77 | Ga0074263_102401 | 3300005485 | Bacteria | 3561 |
| 78 | Ga0466703_014348 | 3300042636 | Bacteria | 47725 |
| 79 | Ga0466703_110538 | 3300042636 | Bacteria | 8465 |
| 80 | Ga0466703_180618 | 3300042636 | Bacteria | 6427 |
| 81 | Ga0466704_449099 | 3300042643 | Bacteria | 67975 |
| 82 | Ga0466709_229433 | 3300042648 | Bacteria | 3929 |
| 83 | Ga0466708_063321 | 3300042652 | Bacteria | 4362 |
| 84 | Ga0466705_217435 | 3300042612 | Bacteria | 3053 |
| 85 | Ga0466705_378404 | 3300042612 | Bacteria | 7004 |
| 86 | Ga0466711_309604 | 3300042615 | Bacteria | 3648 |
| 87 | Ga0466718_140902 | 3300042617 | Bacteria | 7925 |
| 88 | Ga0466723_158039 | 3300042618 | Bacteria | 2058 |
| 89 | Ga0466723_239728 | 3300042618 | Bacteria | 39695 |
| 90 | Ga0123353_10210987 | 3300010167 | Bacteria | 3046 |
| 91 | Ga0123353_10612941 | 3300010167 | Bacteria | 1552 |
| 92 | Ga0123353_10788748 | 3300010167 | Bacteria | 1314 |
| 93 | Ga0466690_006546 | 3300042590 | Unclassified | 2270 |
| 94 | Ga0466690_155308 | 3300042590 | Bacteria | 1708 |
| 95 | Ga0466690_329367 | 3300042590 | Bacteria | 2400 |
| 96 | Ga0466692_169496 | 3300042591 | Bacteria | 1812 |
| 97 | Ga0466694_270008 | 3300042594 | Bacteria | 13452 |
| 98 | Ga0466699_396805 | 3300042597 | Bacteria | 10572 |
| 99 | Ga0466707_073099 | 3300042601 | Bacteria | 1250 |
| 100 | Ga0466713_120810 | 3300042602 | Bacteria | 10449 |
| 101 | Ga0466719_398493 | 3300042606 | Bacteria | 16791 |
| 102 | Ga0466698_332604 | 3300042610 | Bacteria | 2556 |
| 103 | JGI24698J34947_10001245 | 3300002449 | Bacteria | 13310 |
| 104 | JGI24702J35022_10001174 | 3300002462 | Bacteria | 16292 |
| 105 | Ga0466703_228889 | 3300042636 | Bacteria | 15799 |
| 106 | Ga0466704_010138 | 3300042643 | Bacteria | 28747 |
| 107 | Ga0466704_256032 | 3300042643 | Bacteria | 9743 |
| 108 | Ga0466708_437178 | 3300042652 | Bacteria | 6054 |
| 109 | Ga0466727_148789 | 3300042655 | Bacteria | 1493 |
| 110 | Ga0466705_022134 | 3300042612 | Bacteria | 3629 |
| 111 | Ga0466733_042681 | 3300042659 | Bacteria | 1840 |
| 112 | Ga0466711_154912 | 3300042615 | Bacteria | 10152 |
| 113 | Ga0466715_102247 | 3300042616 | Bacteria | 4269 |
| 114 | Ga0466715_179799 | 3300042616 | Bacteria | 9940 |
| 115 | Ga0466718_126601 | 3300042617 | Bacteria | 2251 |
| 116 | Ga0466728_097229 | 3300042620 | Bacteria | 2926 |
| 117 | Ga0123356_10278588 | 3300010049 | Bacteria | 1766 |
| 118 | Ga0123354_10239827 | 3300010882 | Unclassified | 1869 |
| 119 | Ga0264413_103163 | 3300024493 | Bacteria | 13008 |
| 120 | Ga0264413_146950 | 3300024493 | Bacteria | 1859 |
| 121 | Ga0466692_006040 | 3300042591 | Bacteria | 14932 |
| 122 | Ga0466691_008355 | 3300042593 | Bacteria | 10363 |
| 123 | Ga0466696_147724 | 3300042596 | Bacteria | 11177 |
| 124 | Ga0466699_392074 | 3300042597 | Bacteria | 2111 |
| 125 | Ga0466706_185122 | 3300042599 | Bacteria | 2122 |
| 126 | Ga0466716_221570 | 3300042605 | Bacteria | 3018 |
| 127 | Ga0466719_361225 | 3300042606 | Bacteria | 4590 |
| 128 | Ga0466719_420530 | 3300042606 | Bacteria | 4628 |
| 129 | Ga0466722_166164 | 3300042609 | Bacteria | 13041 |
| 130 | JGI24698J34947_10003391 | 3300002449 | Bacteria | 8651 |
| 131 | JGI24695J34938_10007958 | 3300002450 | Bacteria | 6124 |
| 132 | JGI24695J34938_10014077 | 3300002450 | Bacteria | 4166 |
| 133 | JGI24702J35022_10013066 | 3300002462 | Bacteria | 4606 |
| 134 | Ga0466735_038047 | 3300042624 | Bacteria | 1130 |
| 135 | Ga0466735_121974 | 3300042624 | Bacteria | 2449 |
| 136 | Ga0466703_055641 | 3300042636 | Bacteria | 24146 |
| 137 | Ga0466708_370761 | 3300042652 | Bacteria | 4543 |
| 138 | Ga0466727_279517 | 3300042655 | Bacteria | 1584 |
| 139 | Ga0466705_121234 | 3300042612 | Bacteria | 11678 |
| 140 | Ga0466732_341401 | 3300042656 | Archaea | 2502 |
| 141 | Ga0466733_113882 | 3300042659 | Bacteria | 1608 |
| 142 | Ga0466705_504575 | 3300042612 | Bacteria | 11465 |
| 143 | Ga0466711_024854 | 3300042615 | Bacteria | 5156 |
| 144 | Ga0466711_278747 | 3300042615 | Bacteria | 7233 |
| 145 | Ga0466715_329219 | 3300042616 | Bacteria | 6320 |
| 146 | Ga0466715_340353 | 3300042616 | Bacteria | 13837 |
| 147 | Ga0466718_052020 | 3300042617 | Bacteria | 2921 |
| 148 | Ga0466726_356473 | 3300042619 | Bacteria | 6682 |
| 149 | Ga0466728_260059 | 3300042620 | Bacteria | 3912 |
| 150 | Ga0123357_10151886 | 3300009784 | Bacteria | 2807 |
| 151 | Ga0123356_10001680 | 3300010049 | Bacteria | 24216 |
| 152 | Ga0466690_151037 | 3300042590 | Bacteria | 10185 |
| 153 | Ga0466696_006153 | 3300042596 | Bacteria | 10272 |
| 154 | Ga0466696_208736 | 3300042596 | Bacteria | 1783 |
| 155 | Ga0466722_164832 | 3300042609 | Bacteria | 1224 |
| 156 | Ga0466722_186940 | 3300042609 | Bacteria | 5405 |
| 157 | Ga0466698_417956 | 3300042610 | Bacteria | 1193 |
| 158 | JGI24698J34947_10019521 | 3300002449 | Bacteria | 3656 |
| 159 | JGI24698J34947_10019765 | 3300002449 | Bacteria | 3629 |
| 160 | JGI24705J35276_12220269 | 3300002504 | Bacteria | 2255 |
| 161 | Ga0466735_091217 | 3300042624 | Bacteria | 2128 |
| 162 | Ga0466703_144769 | 3300042636 | Bacteria | 15489 |
| 163 | Ga0466704_151004 | 3300042643 | Bacteria | 4833 |
| 164 | Ga0466704_501971 | 3300042643 | Bacteria | 19586 |
| 165 | Ga0466727_180079 | 3300042655 | Bacteria | 2212 |
| 166 | Ga0466727_295281 | 3300042655 | Bacteria | 16121 |
| 167 | Ga0466732_024126 | 3300042656 | Bacteria | 2574 |
| 168 | Ga0466712_058148 | 3300042614 | Bacteria | 26296 |
| 169 | Ga0466712_085801 | 3300042614 | Bacteria | 23112 |
| 170 | Ga0466712_219274 | 3300042614 | Bacteria | 1640 |
| 171 | Ga0466718_082952 | 3300042617 | Bacteria | 1050 |
| 172 | Ga0466723_035696 | 3300042618 | Bacteria | 3772 |
| 173 | Ga0466723_063969 | 3300042618 | Bacteria | 4472 |
| 174 | Ga0466723_157912 | 3300042618 | Bacteria | 2273 |
| 175 | Ga0466726_152269 | 3300042619 | Bacteria | 1122 |
| 176 | Ga0466726_359314 | 3300042619 | Bacteria | 4753 |
| 177 | Ga0123355_10063207 | 3300009826 | Bacteria | 5971 |
| 178 | Ga0264413_139860 | 3300024493 | Unclassified | 2495 |
| 179 | Ga0415639_034442 | 3300038395 | Bacteria | 2062 |
| 180 | Ga0466690_420894 | 3300042590 | Bacteria | 1967 |
| 181 | Ga0466692_005913 | 3300042591 | Bacteria | 4688 |
| 182 | Ga0466691_219032 | 3300042593 | Bacteria | 1383 |
| 183 | Ga0466707_251740 | 3300042601 | Bacteria | 4053 |
| 184 | Ga0466716_181238 | 3300042605 | Bacteria | 5228 |
| 185 | Ga0466719_051060 | 3300042606 | Bacteria | 25452 |
| 186 | Ga0466719_225394 | 3300042606 | Bacteria | 70315 |
| 187 | Ga0466722_242016 | 3300042609 | Bacteria | 2000 |
| 188 | JGI24698J34947_10001787 | 3300002449 | Bacteria | 11467 |
| 189 | JGI24698J34947_10013492 | 3300002449 | Bacteria | 4461 |
| 190 | JGI24695J34938_10012157 | 3300002450 | Bacteria | 4583 |
| 191 | JGI24695J34938_10054770 | 3300002450 | Bacteria | 1727 |
| 192 | Ga0068302_10156906 | 3300005071 | Bacteria | 2830 |
| 193 | Ga0123357_10000083 | 3300009784 | Bacteria | 76734 |
| 194 | Ga0466735_072487 | 3300042624 | Bacteria | 23359 |
| 195 | Ga0466703_073706 | 3300042636 | Bacteria | 44554 |
| 196 | Ga0466704_012581 | 3300042643 | Bacteria | 5236 |
| 197 | Ga0466709_043903 | 3300042648 | Bacteria | 23292 |
| 198 | Ga0466709_092933 | 3300042648 | Bacteria | 51358 |
| 199 | Ga0466708_176116 | 3300042652 | Bacteria | 12016 |
| 200 | Ga0466705_057003 | 3300042612 | Bacteria | 2168 |
| 201 | Ga0466712_028121 | 3300042614 | Bacteria | 13303 |
| 202 | Ga0466715_426008 | 3300042616 | Bacteria | 5934 |
| 203 | Ga0466715_566835 | 3300042616 | Bacteria | 5190 |
| 204 | Ga0466726_038193 | 3300042619 | Bacteria | 2830 |
| 205 | Ga0466726_091048 | 3300042619 | Bacteria | 10629 |
| 206 | Ga0466726_112187 | 3300042619 | Bacteria | 1074 |
| 207 | Ga0466728_245571 | 3300042620 | Bacteria | 9908 |
| 208 | Ga0466728_254592 | 3300042620 | Bacteria | 8729 |
| 209 | Ga0123356_10609522 | 3300010049 | Bacteria | 1257 |
| 210 | Ga0123353_10231670 | 3300010167 | Bacteria | 2879 |
| 211 | Ga0123353_10564434 | 3300010167 | Unclassified | 1638 |
| 212 | Ga0466692_016968 | 3300042591 | Bacteria | 18058 |
| 213 | Ga0466692_124461 | 3300042591 | Bacteria | 5167 |
| 214 | Ga0466693_172557 | 3300042592 | Unclassified | 4254 |
| 215 | Ga0466694_004567 | 3300042594 | Bacteria | 14771 |
| 216 | Ga0466694_031650 | 3300042594 | Bacteria | 4359 |
| 217 | Ga0466695_143313 | 3300042595 | Bacteria | 2801 |
| 218 | Ga0466696_071687 | 3300042596 | Bacteria | 15084 |
| 219 | Ga0466696_310266 | 3300042596 | Bacteria | 1894 |
| 220 | Ga0466700_279736 | 3300042600 | Bacteria | 1446 |
| 221 | Ga0466707_151459 | 3300042601 | Bacteria | 1998 |
| 222 | Ga0466716_158530 | 3300042605 | Bacteria | 23396 |
| 223 | Ga0466719_093369 | 3300042606 | Unclassified | 12405 |
| 224 | Ga0466720_029624 | 3300042607 | Bacteria | 3055 |
| 225 | Ga0466722_014161 | 3300042609 | Bacteria | 25862 |
| 226 | Ga0466722_268350 | 3300042609 | Bacteria | 4501 |
| 227 | AustNasuHG_c1003839 | 3300000089 | Bacteria | 5411 |
| 228 | JGI24698J34947_10005553 | 3300002449 | Bacteria | 6918 |
| 229 | JGI24695J34938_10058006 | 3300002450 | Bacteria | 1662 |
| 230 | Ga0068302_10146650 | 3300005071 | Bacteria | 1863 |
| 231 | Ga0466735_064959 | 3300042624 | Bacteria | 1224 |
| 232 | Ga0466703_344903 | 3300042636 | Bacteria | 11901 |
| 233 | Ga0466709_282768 | 3300042648 | Bacteria | 9554 |
| 234 | Ga0466709_397166 | 3300042648 | Unclassified | 6097 |
| 235 | Ga0466727_215031 | 3300042655 | Bacteria | 6126 |
| 236 | Ga0466727_329245 | 3300042655 | Bacteria | 2197 |
MSA Aligner
Functional Annotation
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF00149 | GO:0016787 | hydrolase activity | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.