Protein Family IF07007

Metagenome Isolate
167 Members
53 Samples
166 Scaffolds
247.74 Avg Length

🧬 Representative Sequence

ID
3300042611|Ga0466697_148940|Ga0466697_148940_546_1355
Length
269 aa
Sequence
VVPVTSAREVASVINQSTIETLKAMRLGAMAATFEEQLKHMERYRDSSFEERFGLVVDAEWNKRQGSKLARHIRNAYFAEPNASIEDIEYYADRKLNKTEMLRLSTCQCIDQHHHIILESASGNGKTYVACALGNAACRKLKTVRYMRMPELLDELSVAKGCGTFKKVIKDLKKVDLLILDEWLLRCVTPQELYDLLEVVESRCNRLTIFCSQYNSKGWYERLGADNESPVIEAILDRIIHNSYEILIEGDLSMRERHGIKAHESGWAR

📊 Sample Types

Isolate 0.6%
Metagenome 99.4%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 67.3%
Kalotermitidae 21.2%
Termopsidae 5.8%
Unclassified 3.8%
Passalidae 1.9%

🌳 Taxonomy

Archaea 2
Bacteria 142
Eukaryota 0
Viruses 0
Unclassified 23

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
2 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
3 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
4 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
5 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
6 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
7 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
8 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
9 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
10 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
11 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
12 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
13 2781125688 Treponema sp. Lab288P4bin13 Isolate Unclassified
14 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
15 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
16 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
17 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
18 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
19 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
20 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
21 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
22 3300002501 Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 Metagenome Termitidae
23 3300005485 Termite gut microbial communities from Costa Rica - P3 luminal contents Metagenome Termitidae
24 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
25 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
26 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
27 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
28 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
29 2030936001 Nasutitermes corniger hindgut microbial communities from Florida, USA Metagenome Termitidae
30 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
31 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
32 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
33 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
34 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
35 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
36 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
37 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
38 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
39 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
40 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
41 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
42 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
43 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
44 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
45 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
46 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
47 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
48 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
49 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
50 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
51 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
52 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
53 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466693_202871 3300042592 Bacteria 3127
2 Ga0466693_307527 3300042592 Bacteria 1144
3 Ga0466695_270604 3300042595 Bacteria 1489
4 Ga0466699_112757 3300042597 Bacteria 1303
5 Ga0466700_208396 3300042600 Bacteria 2983
6 Ga0466707_123180 3300042601 Bacteria 1604
7 Ga0466721_024337 3300042608 Bacteria 2215
8 Ga0466698_426759 3300042610 Bacteria 2252
9 Ga0466715_304057 3300042616 Unclassified 1834
10 Ga0466718_165605 3300042617 Unclassified 1404
11 JGI24698J34947_10042100 3300002449 Bacteria 2349
12 Ga0072940_1266496 3300005200 Bacteria 970
13 Ga0074263_104074 3300005485 Bacteria 1472
14 Ga0123356_10357473 3300010049 Bacteria 1586
15 Ga0123356_10561103 3300010049 Bacteria 1304
16 Ga0123356_10642215 3300010049 Bacteria 1228
17 Ga0123356_10853186 3300010049 Bacteria 1082
18 Ga0123353_10626420 3300010167 Bacteria 1530
19 Ga0466734_060968 3300042623 Bacteria 3029
20 Ga0466734_150290 3300042623 Archaea 2867
21 Ga0466735_130915 3300042624 Bacteria 20944
22 Ga0466708_006542 3300042652 Bacteria 2377
23 Ga0466697_148940 3300042611 Bacteria 2248
24 Ga0466656_330700 3300042550 Bacteria 1318
25 Ga0466696_031157 3300042596 Unclassified 2837
26 Ga0466717_237972 3300042604 Bacteria 2809
27 Ga0466710_075683 3300042613 Unclassified 1576
28 Ga0466710_118275 3300042613 Bacteria 1267
29 Ga0466715_238616 3300042616 Bacteria 2963
30 Ga0466726_060260 3300042619 Bacteria 2537
31 Ga0123356_10125360 3300010049 Bacteria 2506
32 Ga0123353_10136104 3300010167 Bacteria 3940
33 Ga0123353_10766525 3300010167 Bacteria 1339
34 Ga0466734_114971 3300042623 Bacteria 1237
35 Ga0466734_126436 3300042623 Bacteria 1270
36 Ga0466702_051207 3300042635 Bacteria 1376
37 Ga0466702_143453 3300042635 Bacteria 3295
38 Ga0466709_074536 3300042648 Bacteria 2833
39 Ga0466725_104964 3300042654 Bacteria 2851
40 Ga0466697_239394 3300042611 Bacteria 3038
41 Ga0415639_043307 3300038395 Bacteria 2312
42 Ga0466694_219545 3300042594 Bacteria 1345
43 Ga0466696_127334 3300042596 Bacteria 2980
44 Ga0466701_022103 3300042598 Bacteria 1261
45 Ga0466698_204735 3300042610 Bacteria 2437
46 Ga0466710_281339 3300042613 Bacteria 1213
47 Ga0466712_131879 3300042614 Bacteria 1025
48 Ga0466728_403156 3300042620 Bacteria 4254
49 JGI24698J34947_10080744 3300002449 Bacteria 1527
50 JGI24698J34947_10082271 3300002449 Bacteria 1506
51 JGI24702J35022_10034879 3300002462 Bacteria 2691
52 JGI24702J35022_10348270 3300002462 Bacteria 885
53 Ga0068302_10125969 3300005071 Bacteria 2592
54 Ga0072941_1157050 3300005201 Bacteria 1017
55 Ga0123355_10713714 3300009826 Unclassified 1146
56 Ga0123356_10045588 3300010049 Bacteria 4079
57 Ga0123356_10095993 3300010049 Bacteria 2834
58 Ga0123356_10233284 3300010049 Bacteria 1906
59 Ga0123356_11230649 3300010049 Bacteria 914
60 Ga0123353_10451266 3300010167 Bacteria 1893
61 Ga0123353_10487024 3300010167 Unclassified 1802
62 Ga0466731_057240 3300042622 Bacteria 1372
63 Ga0466731_060300 3300042622 Bacteria 1695
64 Ga0415639_099051 3300038395 Bacteria 2707
65 Ga0466720_030954 3300042607 Bacteria 8336
66 Ga0466720_183064 3300042607 Bacteria 1031
67 Ga0466705_411298 3300042612 Bacteria 1159
68 Ga0466711_408783 3300042615 Bacteria 5191
69 IMNBL1DRAFT_c0019641 3300000062 Bacteria 2760
70 JGI24698J34947_10118721 3300002449 Bacteria 1152
71 JGI24702J35022_10026076 3300002462 Bacteria 3151
72 Ga0072940_1003454 3300005200 Bacteria 3903
73 Ga0123357_10390707 3300009784 Unclassified 1279
74 Ga0123356_10088227 3300010049 Bacteria 2948
75 Ga0123356_10170979 3300010049 Bacteria 2184
76 Ga0123356_10560984 3300010049 Bacteria 1304
77 Ga0123356_10597076 3300010049 Bacteria 1268
78 Ga0123353_10166487 3300010167 Bacteria 3503
79 Ga0123353_10446146 3300010167 Bacteria 1907
80 Ga0123353_10741702 3300010167 Bacteria 1369
81 Ga0466731_087941 3300042622 Bacteria 1775
82 Ga0466731_180070 3300042622 Bacteria 2722
83 Ga0466734_108235 3300042623 Bacteria 3030
84 Ga0466704_270642 3300042643 Bacteria 2503
85 Ga0466709_097569 3300042648 Unclassified 2878
86 Ga0466709_197638 3300042648 Bacteria 3687
87 Ga0466725_394307 3300042654 Bacteria 4210
88 Ga0415639_003917 3300038395 Unclassified 1473
89 Ga0466691_095761 3300042593 Bacteria 2740
90 Ga0466707_312736 3300042601 Bacteria 2732
91 Ga0466717_205812 3300042604 Bacteria 1166
92 Ga0466721_371685 3300042608 Bacteria 1232
93 Ga0466710_294744 3300042613 Bacteria 1956
94 Nasutiter_Contig09893 2030936001 Unclassified 3024
95 IMNBL1DRAFT_c0058445 3300000062 Bacteria 1171
96 JGI24703J35330_11727108 3300002501 Bacteria 2574
97 Ga0123356_10231325 3300010049 Unclassified 1913
98 Ga0123356_10584283 3300010049 Bacteria 1281
99 Ga0123356_11056071 3300010049 Unclassified 981
100 Ga0123353_10360471 3300010167 Bacteria 2185
101 Ga0123354_10541567 3300010882 Bacteria 883
102 Ga0466731_357279 3300042622 Bacteria 1485
103 Ga0466735_044663 3300042624 Unclassified 2096
104 Ga0466704_124819 3300042643 Bacteria 1521
105 Ga0466709_022543 3300042648 Unclassified 2676
106 Ga0466725_445107 3300042654 Bacteria 1806
107 Ga0415639_006880 3300038395 Unclassified 2006
108 Ga0415639_012070 3300038395 Bacteria 4790
109 Ga0466699_292715 3300042597 Bacteria 1294
110 Ga0466707_176126 3300042601 Unclassified 1062
111 Ga0466711_039903 3300042615 Bacteria 3404
112 Ga0466715_533828 3300042616 Bacteria 3093
113 JGI24695J34938_10029607 3300002450 Bacteria 2559
114 JGI24702J35022_10030099 3300002462 Unclassified 2912
115 JGI24702J35022_10032194 3300002462 Bacteria 2808
116 Ga0072941_1123696 3300005201 Bacteria 1296
117 Ga0072941_1260834 3300005201 Bacteria 2554
118 Ga0123357_10171276 3300009784 Bacteria 2568
119 Ga0123356_10297414 3300010049 Bacteria 1718
120 Ga0123356_10540748 3300010049 Bacteria 1325
121 Ga0123353_10172528 3300010167 Bacteria 3431
122 Ga0123353_10291979 3300010167 Unclassified 2495
123 Ga0466731_347162 3300042622 Bacteria 2011
124 Ga0466735_020520 3300042624 Bacteria 2968
125 Ga0466704_314754 3300042643 Unclassified 1715
126 Ga0466733_006263 3300042659 Bacteria 3332
127 Ga0466693_137278 3300042592 Bacteria 1104
128 Ga0466694_122308 3300042594 Bacteria 2940
129 Ga0466694_208972 3300042594 Bacteria 1253
130 Ga0466717_033313 3300042604 Unclassified 1149
131 Ga0466717_066041 3300042604 Bacteria 1147
132 Ga0466716_131951 3300042605 Bacteria 3306
133 Ga0466721_009943 3300042608 Bacteria 1302
134 Ga0466698_402613 3300042610 Bacteria 2091
135 Ga0466712_201565 3300042614 Bacteria 3233
136 JGI24702J35022_10033902 3300002462 Bacteria 2731
137 JGI24702J35022_10036453 3300002462 Bacteria 2628
138 JGI24696J40584_12935123 3300002834 Bacteria 1553
139 Ga0123357_10160852 3300009784 Bacteria 2692
140 Ga0123355_10342162 3300009826 Bacteria 1991
141 Ga0123356_10092746 3300010049 Unclassified 2880
142 Ga0123356_10110686 3300010049 Bacteria 2652
143 Ga0123356_10382144 3300010049 Bacteria 1541
144 Ga0123354_10308657 3300010882 Bacteria 1482
145 Ga0123354_10338658 3300010882 Unclassified 1359
146 Ga0466724_25320 3300042649 Bacteria 1285
147 Ga0466705_124917 3300042612 Bacteria 16125
148 Ga0466701_042929 3300042598 Bacteria 3235
149 Ga0466701_086039 3300042598 Bacteria 2622
150 Ga0466721_008997 3300042608 Bacteria 1479
151 Ga0466721_394455 3300042608 Bacteria 2111
152 Ga0466697_051309 3300042611 Bacteria 2299
153 Ga0466710_122393 3300042613 Bacteria 1116
154 Ga0466723_300274 3300042618 Unclassified 3847
155 Ga0466726_367952 3300042619 Bacteria 1741
156 JGI24698J34947_10050830 3300002449 Bacteria 2088
157 JGI24702J35022_10033616 3300002462 Bacteria 2743
158 Ga0123357_10017651 3300009784 Bacteria 9454
159 Ga0123356_10046172 3300010049 Bacteria 4052
160 Ga0123356_10469802 3300010049 Bacteria 1409
161 Ga0123356_10594750 3300010049 Archaea 1271
162 Ga0123354_10145694 3300010882 Bacteria 2900
163 Ga0466731_122298 3300042622 Bacteria 1008
164 Ga0466731_201953 3300042622 Bacteria 2892
165 Ga0466734_038801 3300042623 Bacteria 3306
166 Ga0466702_168722 3300042635 Bacteria 3106

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300038395 Ga0415639_006880 Ga0415639_006880_540_1217 225
2 3300042594 Ga0466694_219545 Ga0466694_219545_178_867 229
3 3300042654 Ga0466725_104964 Ga0466725_104964_269_958 229
4 3300002449 JGI24698J34947_10042100 JGI24698J34947_100421001 235
5 3300002449 JGI24698J34947_10050830 JGI24698J34947_100508302 235
6 3300042608 Ga0466721_371685 Ga0466721_371685_431_1141 236
7 3300042611 Ga0466697_051309 Ga0466697_051309_14_736 240
8 3300038395 Ga0415639_012070 Ga0415639_012070_4008_4733 241
9 3300042592 Ga0466693_202871 Ga0466693_202871_487_1224 245
10 3300042593 Ga0466691_095761 Ga0466691_095761_226_963 245
11 3300042594 Ga0466694_208972 Ga0466694_208972_212_949 245
12 3300042600 Ga0466700_208396 Ga0466700_208396_314_1051 245
13 3300042604 Ga0466717_033313 Ga0466717_033313_93_830 245
14 3300042604 Ga0466717_205812 Ga0466717_205812_398_1135 245
15 3300042605 Ga0466716_131951 Ga0466716_131951_325_1062 245
16 3300042610 Ga0466698_426759 Ga0466698_426759_1190_1927 245
17 3300042611 Ga0466697_239394 Ga0466697_239394_1872_2609 245
18 3300042613 Ga0466710_075683 Ga0466710_075683_307_1044 245
19 3300042615 Ga0466711_408783 Ga0466711_408783_1436_2173 245
20 3300042617 Ga0466718_165605 Ga0466718_165605_562_1299 245
21 3300042620 Ga0466728_403156 Ga0466728_403156_915_1652 245
22 3300042622 Ga0466731_122298 Ga0466731_122298_182_919 245
23 3300042623 Ga0466734_108235 Ga0466734_108235_435_1172 245
24 3300042648 Ga0466709_022543 Ga0466709_022543_1087_1824 245
25 2030936001 Nasutiter_Contig09893 Nasutiterm_1545840 246
26 3300002462 JGI24702J35022_10348270 JGI24702J35022_103482701 246
27 3300005201 Ga0072941_1123696 Ga0072941_11236962 246
28 3300005201 Ga0072941_1157050 Ga0072941_11570501 246
29 3300009826 Ga0123355_10342162 Ga0123355_103421623 246
30 3300010049 Ga0123356_10560984 Ga0123356_105609842 246
31 3300010049 Ga0123356_10584283 Ga0123356_105842832 246
32 3300038395 Ga0415639_003917 Ga0415639_003917_108_848 246
33 3300038395 Ga0415639_043307 Ga0415639_043307_705_1445 246
34 3300042550 Ga0466656_330700 Ga0466656_330700_464_1204 246
35 3300042592 Ga0466693_137278 Ga0466693_137278_227_967 246
36 3300042592 Ga0466693_307527 Ga0466693_307527_177_917 246
37 3300042594 Ga0466694_122308 Ga0466694_122308_1958_2698 246
38 3300042595 Ga0466695_270604 Ga0466695_270604_704_1444 246
39 3300042596 Ga0466696_031157 Ga0466696_031157_513_1253 246
40 3300042596 Ga0466696_127334 Ga0466696_127334_1907_2647 246
41 3300042597 Ga0466699_292715 Ga0466699_292715_44_784 246
42 3300042598 Ga0466701_022103 Ga0466701_022103_219_959 246
43 3300042598 Ga0466701_042929 Ga0466701_042929_1925_2665 246
44 3300042598 Ga0466701_086039 Ga0466701_086039_1565_2305 246
45 3300042601 Ga0466707_123180 Ga0466707_123180_279_1019 246
46 3300042604 Ga0466717_066041 Ga0466717_066041_33_773 246
47 3300042607 Ga0466720_183064 Ga0466720_183064_46_786 246
48 3300042608 Ga0466721_008997 Ga0466721_008997_647_1387 246
49 3300042608 Ga0466721_009943 Ga0466721_009943_221_961 246
50 3300042608 Ga0466721_024337 Ga0466721_024337_1448_2188 246
51 3300042608 Ga0466721_394455 Ga0466721_394455_1145_1885 246
52 3300042610 Ga0466698_204735 Ga0466698_204735_169_909 246
53 3300042610 Ga0466698_402613 Ga0466698_402613_462_1202 246
54 3300042612 Ga0466705_124917 Ga0466705_124917_452_1192 246
55 3300042612 Ga0466705_411298 Ga0466705_411298_257_997 246
56 3300042613 Ga0466710_118275 Ga0466710_118275_188_928 246
57 3300042613 Ga0466710_281339 Ga0466710_281339_40_780 246
58 3300042613 Ga0466710_294744 Ga0466710_294744_206_946 246
59 3300042614 Ga0466712_201565 Ga0466712_201565_2026_2766 246
60 3300042615 Ga0466711_039903 Ga0466711_039903_2426_3166 246
61 3300042616 Ga0466715_238616 Ga0466715_238616_2190_2930 246
62 3300042616 Ga0466715_304057 Ga0466715_304057_589_1329 246
63 3300042616 Ga0466715_533828 Ga0466715_533828_1945_2685 246
64 3300042618 Ga0466723_300274 Ga0466723_300274_716_1456 246
65 3300042619 Ga0466726_060260 Ga0466726_060260_682_1422 246
66 3300042619 Ga0466726_367952 Ga0466726_367952_867_1607 246
67 3300042622 Ga0466731_057240 Ga0466731_057240_432_1172 246
68 3300042622 Ga0466731_060300 Ga0466731_060300_432_1172 246
69 3300042622 Ga0466731_087941 Ga0466731_087941_354_1094 246
70 3300042622 Ga0466731_201953 Ga0466731_201953_1748_2488 246
71 3300042622 Ga0466731_347162 Ga0466731_347162_1097_1837 246
72 3300042622 Ga0466731_357279 Ga0466731_357279_165_905 246
73 3300042623 Ga0466734_114971 Ga0466734_114971_144_884 246
74 3300042623 Ga0466734_126436 Ga0466734_126436_393_1133 246
75 3300042623 Ga0466734_150290 Ga0466734_150290_314_1054 246
76 3300042624 Ga0466735_020520 Ga0466735_020520_1944_2684 246
77 3300042624 Ga0466735_044663 Ga0466735_044663_565_1305 246
78 3300042624 Ga0466735_130915 Ga0466735_130915_15659_16399 246
79 3300042635 Ga0466702_051207 Ga0466702_051207_443_1183 246
80 3300042635 Ga0466702_143453 Ga0466702_143453_1941_2681 246
81 3300042635 Ga0466702_168722 Ga0466702_168722_156_896 246
82 3300042643 Ga0466704_124819 Ga0466704_124819_121_861 246
83 3300042643 Ga0466704_270642 Ga0466704_270642_1637_2377 246
84 3300042643 Ga0466704_314754 Ga0466704_314754_686_1426 246
85 3300042648 Ga0466709_074536 Ga0466709_074536_1749_2489 246
86 3300042648 Ga0466709_097569 Ga0466709_097569_1804_2544 246
87 3300042648 Ga0466709_197638 Ga0466709_197638_215_955 246
88 3300042649 Ga0466724_25320 Ga0466724_25320_513_1253 246
89 3300042652 Ga0466708_006542 Ga0466708_006542_1562_2302 246
90 3300042654 Ga0466725_445107 Ga0466725_445107_242_982 246
91 iso_pr_bacteria 2781125688 2781424541 246
92 3300002449 JGI24698J34947_10080744 JGI24698J34947_100807442 247
93 3300002449 JGI24698J34947_10118721 JGI24698J34947_101187212 247
94 3300002450 JGI24695J34938_10029607 JGI24695J34938_100296074 247
95 3300002462 JGI24702J35022_10026076 JGI24702J35022_100260763 247
96 3300002462 JGI24702J35022_10030099 JGI24702J35022_100300991 247
97 3300002462 JGI24702J35022_10032194 JGI24702J35022_100321941 247
98 3300002462 JGI24702J35022_10033616 JGI24702J35022_100336162 247
99 3300002462 JGI24702J35022_10034879 JGI24702J35022_100348792 247
100 3300002462 JGI24702J35022_10036453 JGI24702J35022_100364532 247
101 3300002501 JGI24703J35330_11727108 JGI24703J35330_117271082 247
102 3300002834 JGI24696J40584_12935123 JGI24696J40584_129351232 247
103 3300005071 Ga0068302_10125969 Ga0068302_101259692 247
104 3300005200 Ga0072940_1003454 Ga0072940_10034545 247
105 3300005485 Ga0074263_104074 Ga0074263_1040742 247
106 3300009784 Ga0123357_10017651 Ga0123357_1001765112 247
107 3300009784 Ga0123357_10160852 Ga0123357_101608521 247
108 3300009784 Ga0123357_10171276 Ga0123357_101712762 247
109 3300009784 Ga0123357_10390707 Ga0123357_103907072 247
110 3300009826 Ga0123355_10713714 Ga0123355_107137141 247
111 3300010049 Ga0123356_10110686 Ga0123356_101106862 247
112 3300010049 Ga0123356_10125360 Ga0123356_101253602 247
113 3300010049 Ga0123356_10170979 Ga0123356_101709792 247
114 3300010049 Ga0123356_10231325 Ga0123356_102313252 247
115 3300010049 Ga0123356_10233284 Ga0123356_102332841 247
116 3300010049 Ga0123356_10297414 Ga0123356_102974142 247
117 3300010049 Ga0123356_10357473 Ga0123356_103574732 247
118 3300010049 Ga0123356_10382144 Ga0123356_103821441 247
119 3300010049 Ga0123356_10540748 Ga0123356_105407482 247
120 3300010049 Ga0123356_10561103 Ga0123356_105611032 247
121 3300010049 Ga0123356_10594750 Ga0123356_105947502 247
122 3300010049 Ga0123356_10597076 Ga0123356_105970762 247
123 3300010049 Ga0123356_10642215 Ga0123356_106422152 247
124 3300010049 Ga0123356_10853186 Ga0123356_108531861 247
125 3300010049 Ga0123356_11056071 Ga0123356_110560711 247
126 3300010049 Ga0123356_11230649 Ga0123356_112306491 247
127 3300010167 Ga0123353_10166487 Ga0123353_101664872 247
128 3300010167 Ga0123353_10451266 Ga0123353_104512662 247
129 3300010167 Ga0123353_10487024 Ga0123353_104870242 247
130 3300010167 Ga0123353_10626420 Ga0123353_106264202 247
131 3300010167 Ga0123353_10766525 Ga0123353_107665251 247
132 3300010882 Ga0123354_10145694 Ga0123354_101456943 247
133 3300042604 Ga0466717_237972 Ga0466717_237972_1800_2543 247
134 3300042659 Ga0466733_006263 Ga0466733_006263_2048_2791 247
135 3300010049 Ga0123356_10045588 Ga0123356_100455882 248
136 3300010049 Ga0123356_10095993 Ga0123356_100959932 248
137 3300010167 Ga0123353_10446146 Ga0123353_104461461 248
138 3300038395 Ga0415639_099051 Ga0415639_099051_352_1098 248
139 3300010049 Ga0123356_10469802 Ga0123356_104698022 249
140 3300010167 Ga0123353_10741702 Ga0123353_107417022 249
141 3300010882 Ga0123354_10308657 Ga0123354_103086572 249
142 3300000062 IMNBL1DRAFT_c0058445 IMNBL1DRAFT_00584451 250
143 3300002462 JGI24702J35022_10033902 JGI24702J35022_100339022 251
144 3300042601 Ga0466707_176126 Ga0466707_176126_68_823 251
145 3300042622 Ga0466731_180070 Ga0466731_180070_187_942 251
146 3300010049 Ga0123356_10088227 Ga0123356_100882273 252
147 3300010882 Ga0123354_10338658 Ga0123354_103386582 252
148 3300042601 Ga0466707_312736 Ga0466707_312736_201_959 252
149 3300042654 Ga0466725_394307 Ga0466725_394307_1127_1900 257
150 3300000062 IMNBL1DRAFT_c0019641 IMNBL1DRAFT_00196414 258
151 3300005201 Ga0072941_1260834 Ga0072941_12608342 258
152 3300010049 Ga0123356_10046172 Ga0123356_100461723 258
153 3300010049 Ga0123356_10092746 Ga0123356_100927462 258
154 3300010167 Ga0123353_10136104 Ga0123353_101361044 258
155 3300010167 Ga0123353_10172528 Ga0123353_101725282 258
156 3300010167 Ga0123353_10291979 Ga0123353_102919791 258
157 3300010167 Ga0123353_10360471 Ga0123353_103604713 258
158 3300005200 Ga0072940_1266496 Ga0072940_12664961 260
159 3300042613 Ga0466710_122393 Ga0466710_122393_239_1021 260
160 3300042623 Ga0466734_060968 Ga0466734_060968_657_1439 260
161 3300042623 Ga0466734_038801 Ga0466734_038801_1901_2689 262
162 3300010882 Ga0123354_10541567 Ga0123354_105415671 263
163 3300042607 Ga0466720_030954 Ga0466720_030954_557_1354 265
164 3300042597 Ga0466699_112757 Ga0466699_112757_300_1100 266
165 3300042614 Ga0466712_131879 Ga0466712_131879_195_998 267
166 3300042611 Ga0466697_148940 Ga0466697_148940_546_1355 269
167 3300002449 JGI24698J34947_10082271 JGI24698J34947_100822712 288

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01695 IstB_IS21 IstB-like ATP binding protein 21 259 0.93

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF01695 GO:0005524 ATP binding MF

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.82 0.87 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.