Protein Family IF06999

Metagenome Metatranscriptome Isolate
233 Members
118 Samples
164 Scaffolds
180.05 Avg Length

🧬 Representative Sequence

ID
3300042611|Ga0466697_111069|Ga0466697_111069_340_882
Length
175 aa
Sequence
MSRIGKLPVDLPAGVEVRVDENNLVTVKGPNGELFEQVSKLVKIEINDNTLLVKRAADDKTSRAQHGLARTLVNNMVIGVTAGFSKRLLITGVGYKAEKKGDVLVINLGYSHPVELKDPVGNTPTEIIVKGMNKAVVGNYAADIRAWRKPEPYKGKGVRYENEVIRRKEGKTGKK

📊 Sample Types

Isolate 29.6%
Metagenome 69.1%
MAG 0.0%
Metatranscriptome 1.3%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 23.5%
Unclassified 21.7%
Apidae 13.0%
Kalotermitidae 9.6%
Scarabaeidae 6.1%
Pyralidae 4.3%
Rhinotermitidae 2.6%
Termopsidae 2.6%
Tenebrionidae 2.6%
Elmidae 1.7%
Passalidae 1.7%
Blattidae 0.9%
Noctuidae 0.9%
Eresidae 0.9%
Culicidae 0.9%
Ocypodidae 0.9%
Dytiscidae 0.9%
Euphausiidae 0.9%
Bombycidae 0.9%
Portunidae 0.9%
Stratiomyidae 0.9%
Hodotermitidae 0.9%
Hydrophilidae 0.9%

🌳 Taxonomy

Archaea 2
Bacteria 231
Eukaryota 0
Viruses 0
Unclassified 0

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2916873227 Bacillus thuringiensis sv. berliner ATCC 10792 Isolate Pyralidae
2 2940228231 Anaerovoracaceae bacterium PM5-7 Isolate Blattidae
3 2563367190 Bacillus thuringiensis sv. aizawai Leapi01 Isolate Noctuidae
4 2595698197 Melissococcus plutonius H6 Isolate Apidae
5 650716050 Melissococcus plutonius ATCC 35311 Isolate Unclassified
6 8007211731 Enterococcus larvae BWM-S5 Isolate Scarabaeidae
7 8022725327 Bacillus sp. SN10 Isolate Eresidae
8 8022781829 Bacillus sp. VKPM B-3276 Isolate Culicidae
9 8064531044 Terrisporobacter mayombei DSM 6539 Isolate Unclassified
10 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
11 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
12 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
13 2822450720 Bacillus toyonensis AFS052650 Isolate Scarabaeidae
14 2864782175 Bacillus toyonensis S00025 Isolate Elmidae
15 2595698194 Melissococcus plutonius 90.0 Isolate Apidae
16 2595698195 Melissococcus plutonius 119 Isolate Apidae
17 2820593525 Unclassified Firmicutes Emb289P1bin7 Isolate Unclassified
18 2820641689 Unclassified Firmicutes Cu122P5bin5 Isolate Unclassified
19 2820661146 Unclassified Firmicutes Co191P3bin61 Isolate Unclassified
20 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
21 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
22 641736255 Paenibacillus larvae larvae BRL-230010 Isolate Unclassified
23 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
24 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
25 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
26 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
27 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
28 2978778678 Bacillus cereus 25 Isolate Ocypodidae
29 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
30 3300021227 Termite gut microbial communities from nest from French Guiana - 18-5 mRNA SA Metatranscriptome Termitidae
31 2850744690 Paenibacillus larvae larvae DSM 25430 Isolate Apidae
32 2593339125 Clostridium sp. 5 Isolate Termitidae
33 2820223845 Unclassified Firmicutes Th196P4bin57 Isolate Unclassified
34 2820666966 Unclassified Firmicutes Co191P3bin39 Isolate Unclassified
35 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
36 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
37 643886085 Bacillus thuringiensis sv. berliner ATCC 10792 Isolate Pyralidae
38 643886091 Bacillus thuringiensis sv. thuringiensis T01001 Isolate Pyralidae
39 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
40 2873593402 Erysipelothrix sp. HDW6A Isolate Dytiscidae
41 2873597894 Erysipelothrix sp. HDW6B Isolate Unclassified
42 2537562000 Bacillus cereus HD73 Isolate Pyralidae
43 2740892557 Staphylococcus sp. JDR108L-110-1 Isolate Unclassified
44 2820324456 Unclassified Firmicutes Nt197P3bin80 Isolate Unclassified
45 2820690275 Unclassified Firmicutes Co191P1bin72 Isolate Unclassified
46 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
47 8002519755 Planococcus sp. MSAK28401 Isolate Euphausiidae
48 8061045771 Bacillus thuringiensis sv. kurstaki BGSC 4D1 Isolate Bombycidae
49 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
50 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
51 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
52 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
53 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
54 2836667214 Paenibacillus larvae larvae B-3650 Isolate Apidae
55 2849099867 Paenibacillus larvae larvae ERIC_I Isolate Unclassified
56 2852337885 Paenibacillus protaetiae FW100M-2 Isolate Scarabaeidae
57 2864981449 Sporosarcina sp. S00266 Isolate Elmidae
58 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
59 2595698190 Melissococcus plutonius 21.1 Isolate Apidae
60 2627853628 Melissococcus plutonius 82 Isolate Apidae
61 2820314258 Unclassified Firmicutes Nt197P4bin16 Isolate Unclassified
62 2820464928 Unclassified Firmicutes Lab288P3bin121 Isolate Unclassified
63 643886087 Bacillus thuringiensis sv. kurstaki T03a001 Isolate Pyralidae
64 643886090 Bacillus thuringiensis sv. pakistani t13001 Isolate Unclassified
65 8061100935 Bacillus thuringiensis sv. japonensis 62 Isolate
66 2969145278 Bacillus cereus 29 Isolate Portunidae
67 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
68 3300012809 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E11 MG Metagenome
69 2590828840 Clostridium sp. 2 Isolate Termitidae
70 2595698199 Melissococcus plutonius 60 Isolate Apidae
71 2634166424 Clostridium sp. L74 Isolate Scarabaeidae
72 2820594669 Unclassified Firmicutes Emb289P1bin61 Isolate Unclassified
73 2820606014 Unclassified Firmicutes Emb289P1bin49 Isolate Unclassified
74 2820683647 Unclassified Firmicutes Co191P1bin82 Isolate Unclassified
75 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
76 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
77 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
78 8007215774 Enterococcus sp. BWR-S5 Isolate Scarabaeidae
79 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
80 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
81 3300021217 Termite gut microbial communities from nest from French Guiana - 13-5 mRNA SA Metatranscriptome Termitidae
82 8114544644 Enterococcus sp. 9E7_DIV0242 9E7_DIV0242 Isolate
83 2827179085 Paenibacillus alvei DSM 29 Isolate Apidae
84 2849104611 Paenibacillus larvae larvae Eric_IV Isolate Apidae
85 2585428085 Sporobacter termitidis DSM 10068 Isolate Termitidae
86 2590828839 Clostridium sp. 1 Isolate Termitidae
87 2595698193 Melissococcus plutonius B5 Isolate Apidae
88 2595698196 Melissococcus plutonius 49.3 Isolate Apidae
89 2820333861 Unclassified Firmicutes Nt197P3bin72 Isolate Unclassified
90 2820620956 Unclassified Firmicutes Emb289P1bin128 Isolate Unclassified
91 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
92 3300056857 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) Metagenome Tenebrionidae
93 3300057007 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) Metagenome Tenebrionidae
94 8030337018 Tissierella sp. Yu-01 Isolate Stratiomyidae
95 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
96 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
97 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
98 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
99 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
100 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
101 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
102 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
103 2822232166 Bacillus toyonensis AFS084242 Isolate Scarabaeidae
104 2873595552 Erysipelothrix sp. HDW6C Isolate Hydrophilidae
105 2523231078 Paenibacillus larvae larvae 4-309, DSM 25430 Isolate Apidae
106 2595698198 Melissococcus plutonius L9 Isolate Apidae
107 2820246658 Unclassified Firmicutes Th196P3bin70 Isolate Unclassified
108 2820637417 Unclassified Firmicutes Emb289P1bin108 Isolate Unclassified
109 3300056856 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) Metagenome Tenebrionidae
110 8007220153 Enterococcus sp. BWB1-3 Isolate Scarabaeidae
111 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
112 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
113 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
114 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
115 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
116 2971438493 Paenibacillus apiarius NRRL B-23460 Isolate Apidae
117 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
118 3300022232 Termite gut microbial communities from Cavitermes sp. nest - French Guiana - 28-9 mRNA Metatranscriptome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_375982 3300042612 Bacteria 18700
2 Ga0415639_091349 3300038395 Bacteria 1239
3 Ga0466690_164477 3300042590 Bacteria 2513
4 Ga0466696_066447 3300042596 Bacteria 5902
5 Ga0466696_231535 3300042596 Bacteria 8719
6 Ga0466726_341021 3300042619 Bacteria 8956
7 Ga0123356_10508559 3300010049 Bacteria 1361
8 Ga0123356_11230784 3300010049 Bacteria 914
9 Ga0123356_11460347 3300010049 Bacteria 843
10 Ga0123353_10498501 3300010167 Bacteria 1775
11 Ga0123353_11176423 3300010167 Bacteria 1009
12 Ga0466704_152059 3300042643 Bacteria 12795
13 Ga0466704_247371 3300042643 Bacteria 16334
14 Ga0466704_322227 3300042643 Bacteria 202158
15 Ga0466700_133286 3300042600 Bacteria 1592
16 Ga0466707_401523 3300042601 Bacteria 35627
17 Ga0466721_038089 3300042608 Bacteria 1503
18 Ga0466721_121834 3300042608 Bacteria 1341
19 Ga0466722_180016 3300042609 Bacteria 4412
20 2227175242 2225789004 Bacteria 8157
21 JGI24695J34938_10005481 3300002450 Bacteria 7901
22 JGI24702J35022_10164622 3300002462 Bacteria 1251
23 JGI24702J35022_10240461 3300002462 Bacteria 1050
24 JGI24705J35276_12208165 3300002504 Bacteria 1765
25 Ga0466697_111069 3300042611 Bacteria 1162
26 Ga0562374_1064 3300057007 Bacteria 35858
27 Ga0466729_148666 3300042621 Bacteria 2254
28 Ga0123357_10546029 3300009784 Bacteria 928
29 Ga0123356_10013957 3300010049 Bacteria 7729
30 Ga0123356_10106174 3300010049 Bacteria 2703
31 Ga0123356_10512213 3300010049 Bacteria 1357
32 Ga0123356_10590088 3300010049 Bacteria 1275
33 Ga0123356_10854516 3300010049 Bacteria 1081
34 Ga0123356_11911156 3300010049 Archaea 739
35 Ga0123353_10021904 3300010167 Bacteria 9608
36 Ga0123353_10260746 3300010167 Bacteria 2677
37 Ga0123353_10458244 3300010167 Bacteria 1875
38 Ga0123353_11411732 3300010167 Bacteria 894
39 Ga0466735_047090 3300042624 Bacteria 1006
40 Ga0466700_000601 3300042600 Bacteria 2455
41 Ga0466707_225303 3300042601 Bacteria 5784
42 Ga0466719_570289 3300042606 Bacteria 4294
43 Ga0466697_056872 3300042611 Bacteria 2038
44 JGI24695J34938_10000194 3300002450 Bacteria 56974
45 JGI24702J35022_10000742 3300002462 Bacteria 20088
46 JGI24702J35022_10012667 3300002462 Bacteria 4682
47 Ga0466705_211599 3300042612 Bacteria 21797
48 Ga0562374_0064 3300057007 Bacteria 350233
49 Ga0223687_100094 3300021217 Bacteria 12922
50 Ga0466693_122640 3300042592 Bacteria 1367
51 Ga0466715_057129 3300042616 Bacteria 23211
52 Ga0466723_081993 3300042618 Bacteria 5252
53 Ga0466729_151058 3300042621 Bacteria 5310
54 Ga0123355_10000106 3300009826 Bacteria 92457
55 Ga0123355_11494858 3300009826 Bacteria 659
56 Ga0123356_10023435 3300010049 Bacteria 5809
57 Ga0123353_10011361 3300010167 Bacteria 12538
58 Ga0123353_10306207 3300010167 Bacteria 2421
59 Ga0123353_10416457 3300010167 Bacteria 1993
60 Ga0123353_10440373 3300010167 Bacteria 1923
61 Ga0123353_10501692 3300010167 Bacteria 1768
62 Ga0123353_10829276 3300010167 Bacteria 1272
63 Ga0123353_10930230 3300010167 Bacteria 1179
64 Ga0123353_11941716 3300010167 Bacteria 724
65 Ga0123354_10187709 3300010882 Bacteria 2330
66 Ga0160466_107494 3300012809 Bacteria 1284
67 Ga0466725_219704 3300042654 Bacteria 3601
68 Ga0466701_043231 3300042598 Bacteria 1036
69 Ga0466700_467973 3300042600 Archaea 1557
70 Ga0466713_019526 3300042602 Bacteria 2717
71 Ga0466713_038717 3300042602 Bacteria 69897
72 IMNBL1DRAFT_c0001224 3300000062 Bacteria 19401
73 IMNBL1DRAFT_c0004663 3300000062 Bacteria 8133
74 JGI24702J35022_10133716 3300002462 Bacteria 1379
75 Ga0466727_349476 3300042655 Bacteria 8871
76 Ga0466733_081616 3300042659 Bacteria 2060
77 Ga0562375_0506 3300056856 Bacteria 80016
78 Ga0562376_0011 3300056857 Bacteria 876793
79 Ga0415639_039802 3300038395 Bacteria 2653
80 Ga0466693_080324 3300042592 Bacteria 1448
81 Ga0466696_026574 3300042596 Bacteria 48163
82 Ga0466696_279791 3300042596 Bacteria 1152
83 Ga0123355_10000184 3300009826 Bacteria 77545
84 Ga0123356_10023998 3300010049 Bacteria 5739
85 Ga0123356_10243509 3300010049 Bacteria 1871
86 Ga0123353_10315251 3300010167 Bacteria 2377
87 Ga0123353_12177369 3300010167 Bacteria 672
88 Ga0466727_069705 3300042655 Bacteria 8758
89 Ga0466719_218329 3300042606 Bacteria 4661
90 Ga0466719_381029 3300042606 Bacteria 20568
91 Ga0466722_160820 3300042609 Bacteria 3766
92 2227228605 2225789004 Bacteria 1370
93 Ga0466705_046393 3300042612 Bacteria 12809
94 Ga0466705_079320 3300042612 Bacteria 80574
95 Ga0562375_4877 3300056856 Bacteria 9211
96 Ga0466691_122791 3300042593 Bacteria 4489
97 Ga0466696_461051 3300042596 Bacteria 1919
98 Ga0466715_257161 3300042616 Bacteria 85931
99 Ga0466723_232062 3300042618 Bacteria 62764
100 Ga0466726_284715 3300042619 Bacteria 2983
101 Ga0466726_435536 3300042619 Bacteria 8048
102 Ga0123355_10016864 3300009826 Bacteria 11523
103 Ga0123355_10693232 3300009826 Bacteria 1172
104 Ga0123356_10050574 3300010049 Bacteria 3867
105 Ga0123356_10218127 3300010049 Bacteria 1962
106 Ga0123356_12146431 3300010049 Bacteria 698
107 Ga0123353_10047514 3300010167 Bacteria 6827
108 Ga0123353_10064579 3300010167 Bacteria 5874
109 Ga0123353_10250304 3300010167 Bacteria 2745
110 Ga0123353_10335272 3300010167 Bacteria 2287
111 Ga0123353_10386197 3300010167 Bacteria 2091
112 Ga0123353_10745989 3300010167 Bacteria 1364
113 Ga0466704_454951 3300042643 Bacteria 4759
114 Ga0466721_272905 3300042608 Bacteria 1279
115 JGI24695J34938_10001793 3300002450 Bacteria 17658
116 JGI24695J34938_10079377 3300002450 Bacteria 1358
117 JGI24705J35276_12238163 3300002504 Bacteria 16705
118 Ga0466705_357809 3300042612 Bacteria 37083
119 Ga0466694_275409 3300042594 Bacteria 3017
120 Ga0466711_245098 3300042615 Bacteria 3715
121 Ga0123355_10610134 3300009826 Bacteria 1291
122 Ga0123356_10197698 3300010049 Bacteria 2048
123 Ga0123356_10242048 3300010049 Bacteria 1876
124 Ga0123353_10000274 3300010167 Bacteria 64224
125 Ga0123353_10010432 3300010167 Bacteria 12954
126 Ga0123353_10076129 3300010167 Bacteria 5392
127 Ga0123353_10858613 3300010167 Bacteria 1243
128 Ga0466704_124543 3300042643 Bacteria 11491
129 Ga0466704_387670 3300042643 Bacteria 16309
130 Ga0466704_528598 3300042643 Bacteria 2044
131 Ga0466707_406938 3300042601 Bacteria 47814
132 Ga0223688_1002309 3300021227 Bacteria 6518
133 Ga0233288_1015839 3300022232 Bacteria 2121
134 Ga0466693_216614 3300042592 Bacteria 2268
135 Ga0466696_446393 3300042596 Bacteria 2427
136 Ga0123355_10000064 3300009826 Bacteria 113151
137 Ga0123355_10000171 3300009826 Bacteria 79083
138 Ga0123356_10092415 3300010049 Bacteria 2885
139 Ga0123356_11158058 3300010049 Bacteria 940
140 Ga0123353_10101243 3300010167 Bacteria 4644
141 Ga0123353_10217721 3300010167 Bacteria 2989
142 Ga0123353_10323700 3300010167 Bacteria 2338
143 Ga0123353_10451234 3300010167 Bacteria 1893
144 Ga0123353_10950830 3300010167 Bacteria 1162
145 Ga0466703_402033 3300042636 Bacteria 1450
146 Ga0466724_40891 3300042649 Bacteria 1446
147 Ga0466713_155303 3300042602 Bacteria 17735
148 Ga0415639_003020 3300038395 Bacteria 16254
149 Ga0466656_018305 3300042550 Bacteria 1590
150 Ga0466692_130735 3300042591 Bacteria 26218
151 Ga0466696_117417 3300042596 Bacteria 1730
152 Ga0466728_082463 3300042620 Bacteria 32980
153 Ga0123355_10045492 3300009826 Bacteria 7139
154 Ga0123356_10773309 3300010049 Bacteria 1131
155 Ga0123356_12545193 3300010049 Bacteria 641
156 Ga0123353_10024127 3300010167 Bacteria 9226
157 Ga0466734_010997 3300042623 Bacteria 2065
158 Ga0466704_031146 3300042643 Bacteria 38318
159 Ga0466701_042985 3300042598 Bacteria 1971
160 Ga0466706_107205 3300042599 Bacteria 176653
161 Ga0466707_209371 3300042601 Bacteria 1898
162 Ga0466719_158945 3300042606 Bacteria 1286
163 Ga0466722_045557 3300042609 Bacteria 252817
164 JGI24702J35022_10039271 3300002462 Bacteria 2526

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00347 Ribosomal_L6 Ribosomal protein L6 12 83 0.96

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.