Protein Family IF06998
Metagenome
Metatranscriptome
Isolate
592
Members
160
Samples
506
Scaffolds
123.78
Avg Length
Representative Sequence
- ID
- 3300042611|Ga0466697_106430|Ga0466697_106430_980_1432
- Length
- 150 aa
- Sequence
- VKELLELFAAGIHVINRDREAGGNRMARIAGVDLPKDKRIEIALTYIFGIGLPTAKNILAKTGVNPDIRVKALSEEDAQKIRREIEENIKVEGDLRREISMSIKRLIDIGCYRGIRHKLGLPVRGQKTKTNARTRKGPRRTVANKKQAGK
Sample Types
Isolate
14.5%
Metagenome
84.6%
MAG
0.0%
Metatranscriptome
0.8%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
35.9%
Termitidae
25.6%
Blattidae
14.7%
Kalotermitidae
9.6%
Formicidae
2.6%
Termopsidae
2.6%
Rhinotermitidae
1.9%
Stratiomyidae
1.3%
Passalidae
1.3%
Tenebrionidae
0.6%
Hodotermitidae
0.6%
Armadillidiidae
0.6%
Scarabaeidae
0.6%
Apidae
0.6%
Noctuidae
0.6%
Drosophilidae
0.6%
Taxonomy
Archaea
0
Bacteria
397
Eukaryota
0
Viruses
0
Unclassified
195
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2940221333 | Paenibacillus sp. PastF-3 | Isolate | Blattidae |
| 2 | 2940286528 | Lachnospiraceae bacterium PFB1-21 | Isolate | Blattidae |
| 3 | 2940425923 | Paenibacillus sp. PastH-4 | Isolate | Blattidae |
| 4 | 2820941830 | Unclassified Actinobacteria Cu122P5bin49 | Isolate | Unclassified |
| 5 | 2820220859 | Unclassified Firmicutes Th196P4bin59 | Isolate | Unclassified |
| 6 | 2820294436 | Unclassified Firmicutes Th196P3bin104 | Isolate | Unclassified |
| 7 | 2820312173 | Unclassified Firmicutes Nt197P4bin8 | Isolate | Unclassified |
| 8 | 2820321184 | Unclassified Firmicutes Nt197P3bin86 | Isolate | Unclassified |
| 9 | 2820371985 | Unclassified Firmicutes Nt197P3bin100 | Isolate | Unclassified |
| 10 | 2820391468 | Unclassified Firmicutes Nc150P3bin1 | Isolate | Unclassified |
| 11 | 2820451402 | Unclassified Firmicutes Lab288P3bin174 | Isolate | Unclassified |
| 12 | 8030343600 | Proteiniborus sp. MB09-C3 | Isolate | Stratiomyidae |
| 13 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 14 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 15 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 16 | 2983866074 | Paenibacillus polymyxa A18 | Isolate | Unclassified |
| 17 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 18 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 19 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 20 | 3300007188 | Ant gut microbial communities from Cephalotes rohweri, Arizona, USA | Metagenome | Formicidae |
| 21 | 3300022820 | Termite gut microbial communities from Nasutitermes sp. nest - French Guiana - 36-11 mRNA | Metatranscriptome | Termitidae |
| 22 | 2940292506 | Lachnoclostridium sp. PH5-23 | Isolate | Blattidae |
| 23 | 2940400224 | Paenibacillus sp. PastM-2 | Isolate | Blattidae |
| 24 | 2820238527 | Unclassified Firmicutes Th196P3bin90 | Isolate | Unclassified |
| 25 | 2820453354 | Unclassified Firmicutes Lab288P3bin172 | Isolate | Unclassified |
| 26 | 2820488713 | Unclassified Firmicutes Lab288P1bin69 | Isolate | Unclassified |
| 27 | 2820512088 | Unclassified Firmicutes Lab288P1bin4 | Isolate | Unclassified |
| 28 | 2820560510 | Unclassified Firmicutes Emb289P3bin72 | Isolate | Unclassified |
| 29 | 2820584674 | Unclassified Firmicutes Emb289P1bin98 | Isolate | Unclassified |
| 30 | 2820594669 | Unclassified Firmicutes Emb289P1bin61 | Isolate | Unclassified |
| 31 | 2820606014 | Unclassified Firmicutes Emb289P1bin49 | Isolate | Unclassified |
| 32 | 2820683647 | Unclassified Firmicutes Co191P1bin82 | Isolate | Unclassified |
| 33 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 34 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 35 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 36 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 37 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 38 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 39 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 40 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 41 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 42 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 43 | 2820921285 | Unclassified Actinobacteria Emb289P3bin53 | Isolate | Unclassified |
| 44 | 2940264388 | Lachnospiraceae bacterium PFB1-17 | Isolate | Blattidae |
| 45 | 2940267548 | Lachnospiraceae bacterium PFB1-22 | Isolate | Blattidae |
| 46 | 2940280053 | Lachnospiraceae bacterium PF1-22 | Isolate | Blattidae |
| 47 | 2940419646 | Paenibacillus sp. PastF-4 | Isolate | Blattidae |
| 48 | 2944625312 | Dysgonomonas sp. PF1-3 | Isolate | Blattidae |
| 49 | 2820813074 | Unclassified Actinobacteria Nt197P3bin52 | Isolate | Unclassified |
| 50 | 2585428085 | Sporobacter termitidis DSM 10068 | Isolate | Termitidae |
| 51 | 2820227065 | Unclassified Firmicutes Th196P4bin44 | Isolate | Unclassified |
| 52 | 2820254385 | Unclassified Firmicutes Th196P3bin54 | Isolate | Unclassified |
| 53 | 2820447167 | Unclassified Firmicutes Lab288P3bin192 | Isolate | Unclassified |
| 54 | 2820457604 | Unclassified Firmicutes Lab288P3bin15 | Isolate | Unclassified |
| 55 | 2820546020 | Unclassified Firmicutes Lab288P1bin102 | Isolate | Unclassified |
| 56 | 2820620956 | Unclassified Firmicutes Emb289P1bin128 | Isolate | Unclassified |
| 57 | 2820651690 | Unclassified Firmicutes Cu122P3bin6 | Isolate | Unclassified |
| 58 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 59 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 60 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 61 | 3300056564 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) | Metagenome | Tenebrionidae |
| 62 | 8030337018 | Tissierella sp. Yu-01 | Isolate | Stratiomyidae |
| 63 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 64 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 65 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 66 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 67 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 68 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 69 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 70 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 71 | 3300007190 | Ant gut microbial communities from Cephalotes umbraculatus, Peru | Metagenome | Formicidae |
| 72 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 73 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 74 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 75 | 3300012829 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG | Metagenome | Armadillidiidae |
| 76 | 2852337885 | Paenibacillus protaetiae FW100M-2 | Isolate | Scarabaeidae |
| 77 | 2940270707 | Lachnoclostridium sp. PF1-13 | Isolate | Blattidae |
| 78 | 2940380068 | Paenibacillus sp. PastH-2 | Isolate | Blattidae |
| 79 | 2940413413 | Paenibacillus sp. PastH-3 | Isolate | Blattidae |
| 80 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 81 | 2718218155 | Flavobacteriaceae bacterium UJ101 | Isolate | |
| 82 | 2820282995 | Unclassified Firmicutes Th196P3bin147 | Isolate | Unclassified |
| 83 | 2820314258 | Unclassified Firmicutes Nt197P4bin16 | Isolate | Unclassified |
| 84 | 2820340373 | Unclassified Firmicutes Nt197P3bin67 | Isolate | Unclassified |
| 85 | 2820400448 | Unclassified Firmicutes Nc150Mbin1 | Isolate | Unclassified |
| 86 | 3006461590 | Streptomyces sp. RB5 | Isolate | Termitidae |
| 87 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 88 | 3300012809 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E11 MG | Metagenome | |
| 89 | 2820866620 | Unclassified Actinobacteria Lab288P3bin139 | Isolate | Unclassified |
| 90 | 2820906387 | Unclassified Actinobacteria Emb289P4bin41 | Isolate | Unclassified |
| 91 | 2940230426 | Lachnospiraceae bacterium PH5-48 | Isolate | Blattidae |
| 92 | 2940283334 | Lachnospiraceae bacterium PF1-4 | Isolate | Blattidae |
| 93 | 2940295490 | Lachnospiraceae bacterium PH1-22 | Isolate | Blattidae |
| 94 | 2940406939 | Paenibacillus sp. PastM-3 | Isolate | Blattidae |
| 95 | 2820280018 | Unclassified Firmicutes Th196P3bin149 | Isolate | Unclassified |
| 96 | 2820420508 | Unclassified Firmicutes Lab288P3bin68 | Isolate | Unclassified |
| 97 | 2820479655 | Unclassified Firmicutes Lab288P1bin77 | Isolate | Unclassified |
| 98 | 2820492969 | Unclassified Firmicutes Lab288P1bin6 | Isolate | Unclassified |
| 99 | 2820661146 | Unclassified Firmicutes Co191P3bin61 | Isolate | Unclassified |
| 100 | 2820705605 | Unclassified Firmicutes Co191P1bin34 | Isolate | Unclassified |
| 101 | 2820707375 | Unclassified Firmicutes Co191P1bin31 | Isolate | Unclassified |
| 102 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 103 | 651324002 | Acetonema longum APO-1, DSM 6540 | Isolate | Kalotermitidae |
| 104 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 105 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 106 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 107 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 108 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 109 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 110 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 111 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 112 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 113 | 2940277027 | Lachnospiraceae bacterium PF1-21 | Isolate | Blattidae |
| 114 | 2940386776 | Paenibacillus sp. PastF-1 | Isolate | Blattidae |
| 115 | 2820005795 | Unclassified Synergistetes Nt197P3bin106 | Isolate | Unclassified |
| 116 | 2820008971 | Unclassified Synergistetes Lab288P3bin103 | Isolate | Unclassified |
| 117 | 2820418027 | Unclassified Firmicutes Lab288P3bin85 | Isolate | Unclassified |
| 118 | 2820580397 | Unclassified Firmicutes Emb289P3bin133 | Isolate | Unclassified |
| 119 | 2820619171 | Unclassified Firmicutes Emb289P1bin130 | Isolate | Unclassified |
| 120 | 2820639607 | Unclassified Firmicutes Cu122P5bin9 | Isolate | Unclassified |
| 121 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 122 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 123 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 124 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 125 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 126 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 127 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 128 | 2971438493 | Paenibacillus apiarius NRRL B-23460 | Isolate | Apidae |
| 129 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 130 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 131 | 3300022232 | Termite gut microbial communities from Cavitermes sp. nest - French Guiana - 28-9 mRNA | Metatranscriptome | Termitidae |
| 132 | 2940233634 | Lachnoclostridium sp. PF5-10 | Isolate | Blattidae |
| 133 | 2940393498 | Paenibacillus sp. PastF-2 | Isolate | Blattidae |
| 134 | 2820244222 | Unclassified Firmicutes Th196P3bin75 | Isolate | Unclassified |
| 135 | 2820347164 | Unclassified Firmicutes Nt197P3bin58 | Isolate | Unclassified |
| 136 | 2820396902 | Unclassified Firmicutes Nc150P1bin3 | Isolate | Unclassified |
| 137 | 2820657860 | Unclassified Firmicutes Co191P4bin15 | Isolate | Unclassified |
| 138 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 139 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 140 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 141 | 3300007068 | Ant gut microbial communities from Cephalotes simillimus, Peru | Metagenome | Formicidae |
| 142 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 143 | 3300023282 | Termite gut microbial communities from Aparatermes sp. nest - French Guiana - 29-3 mRNA | Metatranscriptome | Termitidae |
| 144 | 2940273867 | Lachnoclostridium sp. PH1-16 | Isolate | Blattidae |
| 145 | 2940289514 | Lachnospiraceae bacterium PM6-15 | Isolate | Blattidae |
| 146 | 2551306396 | Paenibacillus sp. ICGEB2008 | Isolate | Noctuidae |
| 147 | 2576861701 | Paenibacillus sp. JCM 10914 | Isolate | Termitidae |
| 148 | 2820231849 | Unclassified Firmicutes Th196P4bin1 | Isolate | Unclassified |
| 149 | 2820324456 | Unclassified Firmicutes Nt197P3bin80 | Isolate | Unclassified |
| 150 | 2820690275 | Unclassified Firmicutes Co191P1bin72 | Isolate | Unclassified |
| 151 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 152 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 153 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 154 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 155 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 156 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 157 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 158 | 3300007505 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut | Metagenome | Drosophilidae |
| 159 | 3300012805 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E11 MG | Metagenome | |
| 160 | 3300021192 | Termite gut microbial communities from nest - French Guiana - 5_4 mRNA SA | Metatranscriptome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_206495 | 3300042612 | Bacteria | 9920 |
| 2 | Ga0466706_064858 | 3300042599 | Unclassified | 2113 |
| 3 | Ga0466706_269670 | 3300042599 | Bacteria | 79639 |
| 4 | Ga0466707_159517 | 3300042601 | Bacteria | 2560 |
| 5 | Ga0466707_243360 | 3300042601 | Bacteria | 29608 |
| 6 | Ga0466713_025156 | 3300042602 | Bacteria | 41607 |
| 7 | Ga0466713_050335 | 3300042602 | Bacteria | 1749 |
| 8 | Ga0466719_047806 | 3300042606 | Unclassified | 1139 |
| 9 | Ga0466719_146945 | 3300042606 | Bacteria | 1102 |
| 10 | Ga0466719_221065 | 3300042606 | Bacteria | 6404 |
| 11 | Ga0466719_395266 | 3300042606 | Bacteria | 3584 |
| 12 | Ga0466721_100978 | 3300042608 | Bacteria | 228571 |
| 13 | Ga0466722_221521 | 3300042609 | Unclassified | 30191 |
| 14 | Ga0466698_337884 | 3300042610 | Bacteria | 12427 |
| 15 | Ga0123355_10050135 | 3300009826 | Bacteria | 6785 |
| 16 | Ga0123355_10315921 | 3300009826 | Unclassified | 2111 |
| 17 | Ga0123355_11313960 | 3300009826 | Unclassified | 724 |
| 18 | Ga0123356_10039435 | 3300010049 | Bacteria | 4400 |
| 19 | Ga0123356_10054142 | 3300010049 | Bacteria | 3737 |
| 20 | Ga0123356_10084927 | 3300010049 | Unclassified | 3001 |
| 21 | Ga0123356_10397110 | 3300010049 | Unclassified | 1516 |
| 22 | Ga0123356_10569360 | 3300010049 | Unclassified | 1295 |
| 23 | Ga0123356_10751263 | 3300010049 | Unclassified | 1145 |
| 24 | Ga0123356_10981126 | 3300010049 | Unclassified | 1015 |
| 25 | Ga0123356_11121535 | 3300010049 | Unclassified | 954 |
| 26 | Ga0123356_12490228 | 3300010049 | Unclassified | 648 |
| 27 | Ga0123356_12498244 | 3300010049 | Unclassified | 647 |
| 28 | Ga0123353_10059534 | 3300010167 | Bacteria | 6125 |
| 29 | Ga0123353_10157516 | 3300010167 | Unclassified | 3618 |
| 30 | Ga0123353_10244610 | 3300010167 | Unclassified | 2784 |
| 31 | Ga0123353_10259943 | 3300010167 | Unclassified | 2682 |
| 32 | Ga0123353_10634429 | 3300010167 | Unclassified | 1517 |
| 33 | Ga0123353_10656207 | 3300010167 | Unclassified | 1484 |
| 34 | Ga0123353_10676705 | 3300010167 | Unclassified | 1454 |
| 35 | Ga0123353_10940538 | 3300010167 | Unclassified | 1170 |
| 36 | Ga0123353_11303642 | 3300010167 | Unclassified | 943 |
| 37 | Ga0123353_11529569 | 3300010167 | Unclassified | 848 |
| 38 | Ga0466731_411781 | 3300042622 | Unclassified | 2526 |
| 39 | Ga0466735_172128 | 3300042624 | Unclassified | 1606 |
| 40 | Ga0466702_303103 | 3300042635 | Bacteria | 1353 |
| 41 | Ga0466703_190986 | 3300042636 | Bacteria | 2102 |
| 42 | Ga0466703_360640 | 3300042636 | Bacteria | 6191 |
| 43 | Ga0466704_591951 | 3300042643 | Unclassified | 1325 |
| 44 | Ga0466709_207118 | 3300042648 | Bacteria | 10221 |
| 45 | Ga0466708_053951 | 3300042652 | Bacteria | 19818 |
| 46 | Ga0466708_079679 | 3300042652 | Bacteria | 41277 |
| 47 | Ga0466708_211226 | 3300042652 | Unclassified | 5754 |
| 48 | Ga0466708_374147 | 3300042652 | Bacteria | 1751 |
| 49 | Ga0466727_069506 | 3300042655 | Bacteria | 9138 |
| 50 | Ga0466710_311945 | 3300042613 | Unclassified | 1220 |
| 51 | Ga0466711_420482 | 3300042615 | Bacteria | 8461 |
| 52 | Ga0466715_367868 | 3300042616 | Bacteria | 44460 |
| 53 | Ga0466715_552404 | 3300042616 | Bacteria | 8959 |
| 54 | Ga0466715_642022 | 3300042616 | Bacteria | 7468 |
| 55 | Ga0466728_013154 | 3300042620 | Bacteria | 8447 |
| 56 | Ga0255808_1001596 | 3300023282 | Unclassified | 969 |
| 57 | Ga0415639_039146 | 3300038395 | Bacteria | 917 |
| 58 | Ga0415639_109515 | 3300038395 | Bacteria | 1865 |
| 59 | Ga0466657_053311 | 3300042582 | Bacteria | 1172 |
| 60 | Ga0466696_176138 | 3300042596 | Bacteria | 8591 |
| 61 | Ga0466696_445560 | 3300042596 | Unclassified | 2608 |
| 62 | Ga0466699_302977 | 3300042597 | Unclassified | 3092 |
| 63 | 2227173319 | 2225789004 | Bacteria | 1516 |
| 64 | 2227473062 | 2225789004 | Unclassified | 908 |
| 65 | IMNBL1DRAFT_c0003001 | 3300000062 | Bacteria | 11181 |
| 66 | IMNBL1DRAFT_c0037293 | 3300000062 | Bacteria | 1686 |
| 67 | JGI24702J35022_10000321 | 3300002462 | Bacteria | 28517 |
| 68 | JGI24702J35022_10001245 | 3300002462 | Bacteria | 15858 |
| 69 | JGI24702J35022_10097911 | 3300002462 | Unclassified | 1602 |
| 70 | JGI24705J35276_12233870 | 3300002504 | Bacteria | 5119 |
| 71 | Ga0068305_10018402 | 3300005083 | Bacteria | 2369 |
| 72 | Ga0068305_10310197 | 3300005083 | Bacteria | 2518 |
| 73 | Ga0072940_1093076 | 3300005200 | Unclassified | 1402 |
| 74 | Ga0072940_1216662 | 3300005200 | Bacteria | 1501 |
| 75 | Ga0072940_1336217 | 3300005200 | Unclassified | 936 |
| 76 | Ga0466697_175772 | 3300042611 | Unclassified | 1380 |
| 77 | Ga0466705_115618 | 3300042612 | Bacteria | 24638 |
| 78 | Ga0466733_090281 | 3300042659 | Bacteria | 1022 |
| 79 | Ga0466701_081443 | 3300042598 | Unclassified | 1542 |
| 80 | Ga0466706_047158 | 3300042599 | Bacteria | 6142 |
| 81 | Ga0466707_005722 | 3300042601 | Bacteria | 1697 |
| 82 | Ga0466707_422369 | 3300042601 | Bacteria | 1614 |
| 83 | Ga0466717_134450 | 3300042604 | Unclassified | 1998 |
| 84 | Ga0466721_145693 | 3300042608 | Bacteria | 1883 |
| 85 | Ga0466722_035400 | 3300042609 | Bacteria | 82053 |
| 86 | Ga0466698_422804 | 3300042610 | Bacteria | 1213 |
| 87 | Ga0123355_10437759 | 3300009826 | Unclassified | 1658 |
| 88 | Ga0123355_11411973 | 3300009826 | Unclassified | 687 |
| 89 | Ga0123355_11869642 | 3300009826 | Unclassified | 563 |
| 90 | Ga0123356_10031697 | 3300010049 | Bacteria | 4946 |
| 91 | Ga0123356_10049207 | 3300010049 | Bacteria | 3924 |
| 92 | Ga0123356_10437465 | 3300010049 | Unclassified | 1453 |
| 93 | Ga0123356_10497271 | 3300010049 | Unclassified | 1375 |
| 94 | Ga0123356_10647498 | 3300010049 | Unclassified | 1224 |
| 95 | Ga0123353_10000031 | 3300010167 | Bacteria | 160211 |
| 96 | Ga0123353_10014428 | 3300010167 | Bacteria | 11391 |
| 97 | Ga0123353_10047420 | 3300010167 | Bacteria | 6833 |
| 98 | Ga0123353_10113684 | 3300010167 | Bacteria | 4358 |
| 99 | Ga0123353_10130818 | 3300010167 | Bacteria | 4027 |
| 100 | Ga0123353_10278501 | 3300010167 | Unclassified | 2571 |
| 101 | Ga0123353_10327724 | 3300010167 | Bacteria | 2320 |
| 102 | Ga0123353_10614066 | 3300010167 | Unclassified | 1550 |
| 103 | Ga0123353_10695307 | 3300010167 | Bacteria | 1429 |
| 104 | Ga0123353_10990994 | 3300010167 | Unclassified | 1130 |
| 105 | Ga0123353_11987738 | 3300010167 | Unclassified | 713 |
| 106 | Ga0123353_12136463 | 3300010167 | Unclassified | 680 |
| 107 | Ga0123354_10282940 | 3300010882 | Bacteria | 1606 |
| 108 | Ga0123354_10409023 | 3300010882 | Unclassified | 1140 |
| 109 | Ga0160466_100720 | 3300012809 | Bacteria | 13535 |
| 110 | Ga0466735_186546 | 3300042624 | Bacteria | 2719 |
| 111 | Ga0466730_003828 | 3300042625 | Bacteria | 1004 |
| 112 | Ga0466702_083701 | 3300042635 | Unclassified | 1740 |
| 113 | Ga0466702_340988 | 3300042635 | Bacteria | 1757 |
| 114 | Ga0466703_034881 | 3300042636 | Bacteria | 18131 |
| 115 | Ga0466715_043804 | 3300042616 | Bacteria | 8517 |
| 116 | Ga0466723_262454 | 3300042618 | Bacteria | 1367 |
| 117 | Ga0466723_348088 | 3300042618 | Bacteria | 31343 |
| 118 | Ga0466726_051866 | 3300042619 | Bacteria | 8985 |
| 119 | Ga0466726_191343 | 3300042619 | Bacteria | 2509 |
| 120 | Ga0466726_380315 | 3300042619 | Bacteria | 17436 |
| 121 | Ga0222432_1016633 | 3300021192 | Bacteria | 924 |
| 122 | Ga0466657_214154 | 3300042582 | Bacteria | 2521 |
| 123 | Ga0466690_052764 | 3300042590 | Bacteria | 15693 |
| 124 | Ga0466690_070620 | 3300042590 | Unclassified | 1805 |
| 125 | Ga0466696_054148 | 3300042596 | Bacteria | 3103 |
| 126 | 2227358603 | 2225789004 | Unclassified | 6116 |
| 127 | 2227505172 | 2225789004 | Bacteria | 19004 |
| 128 | IMNBL1DRAFT_c0000019 | 3300000062 | Bacteria | 170255 |
| 129 | IMNBL1DRAFT_c0018360 | 3300000062 | Bacteria | 2912 |
| 130 | IMNBL1DRAFT_c0174954 | 3300000062 | Unclassified | 544 |
| 131 | JGI24695J34938_10057492 | 3300002450 | Unclassified | 1671 |
| 132 | JGI24702J35022_10114863 | 3300002462 | Unclassified | 1482 |
| 133 | JGI24702J35022_10207853 | 3300002462 | Unclassified | 1123 |
| 134 | JGI24702J35022_10717071 | 3300002462 | Unclassified | 622 |
| 135 | Ga0072941_1305479 | 3300005201 | Bacteria | 1399 |
| 136 | Ga0103264_1000100 | 3300007188 | Bacteria | 49857 |
| 137 | Ga0466697_106430 | 3300042611 | Bacteria | 2288 |
| 138 | Ga0466697_125654 | 3300042611 | Bacteria | 6128 |
| 139 | Ga0466705_079320 | 3300042612 | Bacteria | 80574 |
| 140 | Ga0530661_000260 | 3300056564 | Unclassified | 42338 |
| 141 | Ga0466706_223170 | 3300042599 | Bacteria | 11130 |
| 142 | Ga0466707_041118 | 3300042601 | Bacteria | 16787 |
| 143 | Ga0466707_375112 | 3300042601 | Bacteria | 17480 |
| 144 | Ga0466714_161914 | 3300042603 | Bacteria | 1975 |
| 145 | Ga0466714_169031 | 3300042603 | Bacteria | 152952 |
| 146 | Ga0466717_133371 | 3300042604 | Unclassified | 1235 |
| 147 | Ga0466717_228710 | 3300042604 | Unclassified | 1436 |
| 148 | Ga0466716_003820 | 3300042605 | Bacteria | 11944 |
| 149 | Ga0466716_462042 | 3300042605 | Bacteria | 1873 |
| 150 | Ga0466719_030580 | 3300042606 | Bacteria | 1074 |
| 151 | Ga0123357_10227153 | 3300009784 | Bacteria | 2055 |
| 152 | Ga0123355_10200728 | 3300009826 | Unclassified | 2914 |
| 153 | Ga0123355_10579663 | 3300009826 | Unclassified | 1342 |
| 154 | Ga0123355_11541626 | 3300009826 | Unclassified | 645 |
| 155 | Ga0123356_10011608 | 3300010049 | Bacteria | 8584 |
| 156 | Ga0123356_10066070 | 3300010049 | Bacteria | 3385 |
| 157 | Ga0123356_10126607 | 3300010049 | Bacteria | 2495 |
| 158 | Ga0123356_10345524 | 3300010049 | Bacteria | 1610 |
| 159 | Ga0123356_10720776 | 3300010049 | Unclassified | 1167 |
| 160 | Ga0123356_12681653 | 3300010049 | Unclassified | 624 |
| 161 | Ga0123356_13000839 | 3300010049 | Unclassified | 589 |
| 162 | Ga0123353_10086758 | 3300010167 | Bacteria | 5041 |
| 163 | Ga0123353_10349101 | 3300010167 | Bacteria | 2230 |
| 164 | Ga0123353_10731328 | 3300010167 | Unclassified | 1382 |
| 165 | Ga0123353_10812576 | 3300010167 | Unclassified | 1289 |
| 166 | Ga0123353_11182484 | 3300010167 | Unclassified | 1006 |
| 167 | Ga0123353_11420484 | 3300010167 | Unclassified | 890 |
| 168 | Ga0123353_11437081 | 3300010167 | Unclassified | 884 |
| 169 | Ga0123353_11694831 | 3300010167 | Unclassified | 792 |
| 170 | Ga0123353_12120901 | 3300010167 | Unclassified | 683 |
| 171 | Ga0123353_12781602 | 3300010167 | Bacteria | 574 |
| 172 | Ga0123354_10018677 | 3300010882 | Bacteria | 10878 |
| 173 | Ga0123354_10060354 | 3300010882 | Bacteria | 5611 |
| 174 | Ga0123354_10364930 | 3300010882 | Bacteria | 1268 |
| 175 | Ga0466731_312270 | 3300042622 | Bacteria | 2718 |
| 176 | Ga0466734_167367 | 3300042623 | Unclassified | 2090 |
| 177 | Ga0466703_241993 | 3300042636 | Bacteria | 19818 |
| 178 | Ga0466704_116527 | 3300042643 | Unclassified | 2068 |
| 179 | Ga0466708_076108 | 3300042652 | Bacteria | 112124 |
| 180 | Ga0466708_274375 | 3300042652 | Bacteria | 21022 |
| 181 | Ga0466727_011350 | 3300042655 | Unclassified | 1618 |
| 182 | Ga0466705_496890 | 3300042612 | Unclassified | 4973 |
| 183 | Ga0466705_519658 | 3300042612 | Bacteria | 15800 |
| 184 | Ga0466710_226748 | 3300042613 | Unclassified | 2123 |
| 185 | Ga0466711_169486 | 3300042615 | Bacteria | 18240 |
| 186 | Ga0466723_149172 | 3300042618 | Bacteria | 10747 |
| 187 | Ga0466723_173974 | 3300042618 | Bacteria | 14831 |
| 188 | Ga0466723_254809 | 3300042618 | Bacteria | 13413 |
| 189 | Ga0466723_259805 | 3300042618 | Bacteria | 11102 |
| 190 | Ga0160467_100322 | 3300012829 | Bacteria | 52269 |
| 191 | Ga0255809_1069686 | 3300022820 | Bacteria | 1864 |
| 192 | Ga0466692_150758 | 3300042591 | Unclassified | 2245 |
| 193 | Ga0466693_115745 | 3300042592 | Bacteria | 8780 |
| 194 | Ga0466691_015234 | 3300042593 | Bacteria | 46974 |
| 195 | Ga0466691_048716 | 3300042593 | Bacteria | 16548 |
| 196 | Ga0466691_056146 | 3300042593 | Bacteria | 34897 |
| 197 | Ga0466691_171488 | 3300042593 | Bacteria | 19589 |
| 198 | Ga0466694_207338 | 3300042594 | Bacteria | 4989 |
| 199 | Ga0466696_146079 | 3300042596 | Unclassified | 1618 |
| 200 | Ga0466696_230686 | 3300042596 | Unclassified | 4092 |
| 201 | Ga0466696_297061 | 3300042596 | Bacteria | 8630 |
| 202 | 2227263570 | 2225789004 | Unclassified | 1294 |
| 203 | JGI24702J35022_10000420 | 3300002462 | Bacteria | 25476 |
| 204 | JGI24705J35276_12238163 | 3300002504 | Bacteria | 16705 |
| 205 | JGI24699J35502_10638993 | 3300002509 | Bacteria | 712 |
| 206 | JGI24696J40584_12942121 | 3300002834 | Bacteria | 1730 |
| 207 | Ga0068305_10178722 | 3300005083 | Bacteria | 13191 |
| 208 | Ga0466697_184941 | 3300042611 | Bacteria | 1881 |
| 209 | Ga0466705_146538 | 3300042612 | Bacteria | 158344 |
| 210 | Ga0466705_160225 | 3300042612 | Bacteria | 45310 |
| 211 | Ga0466706_133678 | 3300042599 | Bacteria | 1217 |
| 212 | Ga0466700_102688 | 3300042600 | Unclassified | 1464 |
| 213 | Ga0466714_014154 | 3300042603 | Bacteria | 4661 |
| 214 | Ga0466719_263003 | 3300042606 | Bacteria | 4933 |
| 215 | Ga0466721_015423 | 3300042608 | Bacteria | 14106 |
| 216 | Ga0466721_204804 | 3300042608 | Bacteria | 2938 |
| 217 | Ga0466722_033664 | 3300042609 | Bacteria | 51377 |
| 218 | Ga0466722_035291 | 3300042609 | Bacteria | 6346 |
| 219 | Ga0123357_10040183 | 3300009784 | Unclassified | 6362 |
| 220 | Ga0123355_10036198 | 3300009826 | Bacteria | 8026 |
| 221 | Ga0123355_10872459 | 3300009826 | Unclassified | 985 |
| 222 | Ga0123355_11776769 | 3300009826 | Unclassified | 583 |
| 223 | Ga0123356_10014493 | 3300010049 | Bacteria | 7579 |
| 224 | Ga0123356_10167745 | 3300010049 | Bacteria | 2202 |
| 225 | Ga0123356_10582417 | 3300010049 | Unclassified | 1282 |
| 226 | Ga0123356_11097182 | 3300010049 | Unclassified | 964 |
| 227 | Ga0123356_11256423 | 3300010049 | Bacteria | 905 |
| 228 | Ga0123356_11596683 | 3300010049 | Unclassified | 807 |
| 229 | Ga0123353_10000274 | 3300010167 | Bacteria | 64224 |
| 230 | Ga0123353_10010432 | 3300010167 | Bacteria | 12954 |
| 231 | Ga0123353_10199634 | 3300010167 | Bacteria | 3148 |
| 232 | Ga0123353_10213427 | 3300010167 | Bacteria | 3025 |
| 233 | Ga0123353_10666105 | 3300010167 | Unclassified | 1469 |
| 234 | Ga0123353_11019394 | 3300010167 | Bacteria | 1110 |
| 235 | Ga0123353_11928722 | 3300010167 | Unclassified | 727 |
| 236 | Ga0123353_12238541 | 3300010167 | Unclassified | 660 |
| 237 | Ga0123353_12678791 | 3300010167 | Unclassified | 588 |
| 238 | Ga0466731_286467 | 3300042622 | Bacteria | 3189 |
| 239 | Ga0466704_124543 | 3300042643 | Bacteria | 11491 |
| 240 | Ga0466709_277451 | 3300042648 | Unclassified | 1293 |
| 241 | Ga0466725_065787 | 3300042654 | Bacteria | 3634 |
| 242 | Ga0466725_438936 | 3300042654 | Unclassified | 1626 |
| 243 | Ga0466710_403640 | 3300042613 | Bacteria | 6861 |
| 244 | Ga0466711_202977 | 3300042615 | Bacteria | 8125 |
| 245 | Ga0466715_082070 | 3300042616 | Unclassified | 2270 |
| 246 | Ga0466723_322684 | 3300042618 | Bacteria | 3300 |
| 247 | Ga0466728_136371 | 3300042620 | Unclassified | 1349 |
| 248 | Ga0466728_181136 | 3300042620 | Bacteria | 1719 |
| 249 | Ga0466728_238217 | 3300042620 | Unclassified | 2195 |
| 250 | Ga0466729_036937 | 3300042621 | Unclassified | 5877 |
| 251 | Ga0233288_1088084 | 3300022232 | Unclassified | 991 |
| 252 | Ga0255809_1010056 | 3300022820 | Unclassified | 1365 |
| 253 | Ga0466690_387239 | 3300042590 | Unclassified | 2588 |
| 254 | Ga0466693_412844 | 3300042592 | Unclassified | 1041 |
| 255 | IMNBL1DRAFT_c0064593 | 3300000062 | Unclassified | 1083 |
| 256 | JGI24702J35022_10000691 | 3300002462 | Bacteria | 20609 |
| 257 | JGI24702J35022_10000871 | 3300002462 | Bacteria | 18695 |
| 258 | Ga0072941_1289434 | 3300005201 | Unclassified | 1405 |
| 259 | Ga0105005_1112256 | 3300007505 | Unclassified | 3998 |
| 260 | Ga0466713_056349 | 3300042602 | Bacteria | 41260 |
| 261 | Ga0466713_129420 | 3300042602 | Unclassified | 38326 |
| 262 | Ga0466716_171481 | 3300042605 | Bacteria | 2188 |
| 263 | Ga0466716_287106 | 3300042605 | Bacteria | 4411 |
| 264 | Ga0466722_245949 | 3300042609 | Unclassified | 3016 |
| 265 | Ga0466722_261327 | 3300042609 | Bacteria | 19029 |
| 266 | Ga0123355_10005165 | 3300009826 | Bacteria | 19051 |
| 267 | Ga0123355_10362529 | 3300009826 | Unclassified | 1908 |
| 268 | Ga0123355_11625980 | 3300009826 | Unclassified | 621 |
| 269 | Ga0123356_10033160 | 3300010049 | Bacteria | 4829 |
| 270 | Ga0123356_10041987 | 3300010049 | Bacteria | 4262 |
| 271 | Ga0123356_10412024 | 3300010049 | Bacteria | 1491 |
| 272 | Ga0123356_10722472 | 3300010049 | Bacteria | 1166 |
| 273 | Ga0123356_10987054 | 3300010049 | Unclassified | 1012 |
| 274 | Ga0123356_11423205 | 3300010049 | Bacteria | 853 |
| 275 | Ga0123353_10464820 | 3300010167 | Unclassified | 1857 |
| 276 | Ga0123353_10709148 | 3300010167 | Unclassified | 1410 |
| 277 | Ga0123353_10955818 | 3300010167 | Unclassified | 1158 |
| 278 | Ga0123353_11173700 | 3300010167 | Bacteria | 1011 |
| 279 | Ga0123353_11403875 | 3300010167 | Unclassified | 897 |
| 280 | Ga0123353_13004456 | 3300010167 | Bacteria | 546 |
| 281 | Ga0123354_10859187 | 3300010882 | Unclassified | 601 |
| 282 | Ga0466729_310680 | 3300042621 | Unclassified | 1069 |
| 283 | Ga0466734_129701 | 3300042623 | Unclassified | 1195 |
| 284 | Ga0466704_173835 | 3300042643 | Unclassified | 1118 |
| 285 | Ga0466704_430292 | 3300042643 | Unclassified | 2701 |
| 286 | Ga0466725_190969 | 3300042654 | Unclassified | 1286 |
| 287 | Ga0466727_142292 | 3300042655 | Unclassified | 4327 |
| 288 | Ga0466727_280896 | 3300042655 | Bacteria | 3189 |
| 289 | Ga0466711_214140 | 3300042615 | Bacteria | 14422 |
| 290 | Ga0466711_301166 | 3300042615 | Bacteria | 1098 |
| 291 | Ga0466711_511518 | 3300042615 | Unclassified | 1628 |
| 292 | Ga0466715_116779 | 3300042616 | Bacteria | 15242 |
| 293 | Ga0466715_374576 | 3300042616 | Bacteria | 3250 |
| 294 | Ga0466718_065172 | 3300042617 | Unclassified | 1862 |
| 295 | Ga0415639_001377 | 3300038395 | Bacteria | 23349 |
| 296 | Ga0415639_006405 | 3300038395 | Bacteria | 33378 |
| 297 | Ga0415639_019624 | 3300038395 | Unclassified | 2603 |
| 298 | Ga0466690_392775 | 3300042590 | Bacteria | 4374 |
| 299 | Ga0466691_201130 | 3300042593 | Bacteria | 16704 |
| 300 | Ga0466694_021830 | 3300042594 | Bacteria | 15157 |
| 301 | Ga0466696_172455 | 3300042596 | Unclassified | 1573 |
| 302 | 2227502504 | 2225789004 | Unclassified | 735 |
| 303 | JGI24695J34938_10026103 | 3300002450 | Bacteria | 2780 |
| 304 | JGI24695J34938_10051551 | 3300002450 | Bacteria | 1800 |
| 305 | JGI24702J35022_10022324 | 3300002462 | Bacteria | 3426 |
| 306 | JGI24702J35022_10386150 | 3300002462 | Unclassified | 843 |
| 307 | Ga0068302_10023687 | 3300005071 | Bacteria | 8489 |
| 308 | Ga0102734_1000004 | 3300007129 | Bacteria | 74698 |
| 309 | Ga0466705_069841 | 3300042612 | Bacteria | 12967 |
| 310 | Ga0466701_057656 | 3300042598 | Unclassified | 1626 |
| 311 | Ga0466706_150029 | 3300042599 | Bacteria | 12161 |
| 312 | Ga0466707_164538 | 3300042601 | Bacteria | 30398 |
| 313 | Ga0466713_031263 | 3300042602 | Unclassified | 1347 |
| 314 | Ga0466717_015734 | 3300042604 | Bacteria | 12599 |
| 315 | Ga0466719_230029 | 3300042606 | Bacteria | 8834 |
| 316 | Ga0466721_379250 | 3300042608 | Unclassified | 1174 |
| 317 | Ga0123357_10752449 | 3300009784 | Bacteria | 677 |
| 318 | Ga0123355_10000171 | 3300009826 | Bacteria | 79083 |
| 319 | Ga0123355_10082782 | 3300009826 | Bacteria | 5117 |
| 320 | Ga0123355_10513670 | 3300009826 | Unclassified | 1470 |
| 321 | Ga0123355_10557290 | 3300009826 | Bacteria | 1382 |
| 322 | Ga0123356_10002442 | 3300010049 | Bacteria | 19870 |
| 323 | Ga0123356_10105118 | 3300010049 | Unclassified | 2716 |
| 324 | Ga0123356_10244603 | 3300010049 | Bacteria | 1867 |
| 325 | Ga0123356_10287420 | 3300010049 | Unclassified | 1743 |
| 326 | Ga0123356_11072017 | 3300010049 | Unclassified | 975 |
| 327 | Ga0123356_11101394 | 3300010049 | Unclassified | 962 |
| 328 | Ga0123356_12093602 | 3300010049 | Bacteria | 706 |
| 329 | Ga0123356_12105021 | 3300010049 | Unclassified | 705 |
| 330 | Ga0123356_12218909 | 3300010049 | Bacteria | 686 |
| 331 | Ga0123356_13010907 | 3300010049 | Bacteria | 588 |
| 332 | Ga0123356_13199348 | 3300010049 | Unclassified | 570 |
| 333 | Ga0123353_10008463 | 3300010167 | Bacteria | 14055 |
| 334 | Ga0123353_10065327 | 3300010167 | Bacteria | 5841 |
| 335 | Ga0123353_10476559 | 3300010167 | Unclassified | 1828 |
| 336 | Ga0123353_10543589 | 3300010167 | Unclassified | 1678 |
| 337 | Ga0123353_10565144 | 3300010167 | Bacteria | 1636 |
| 338 | Ga0123353_11409835 | 3300010167 | Unclassified | 895 |
| 339 | Ga0123353_11774704 | 3300010167 | Unclassified | 768 |
| 340 | Ga0123354_10437287 | 3300010882 | Unclassified | 1071 |
| 341 | Ga0123354_10471916 | 3300010882 | Unclassified | 999 |
| 342 | Ga0466734_000776 | 3300042623 | Unclassified | 3159 |
| 343 | Ga0466702_037397 | 3300042635 | Unclassified | 1158 |
| 344 | Ga0466703_158678 | 3300042636 | Unclassified | 4260 |
| 345 | Ga0466703_205940 | 3300042636 | Bacteria | 26157 |
| 346 | Ga0466704_092701 | 3300042643 | Bacteria | 9103 |
| 347 | Ga0466709_009067 | 3300042648 | Bacteria | 2740 |
| 348 | Ga0466709_384402 | 3300042648 | Bacteria | 15155 |
| 349 | Ga0466708_053272 | 3300042652 | Bacteria | 23559 |
| 350 | Ga0466708_448160 | 3300042652 | Unclassified | 8446 |
| 351 | Ga0466705_403255 | 3300042612 | Bacteria | 37741 |
| 352 | Ga0466710_164580 | 3300042613 | Bacteria | 2243 |
| 353 | Ga0466711_158351 | 3300042615 | Bacteria | 17441 |
| 354 | Ga0466711_404513 | 3300042615 | Unclassified | 3530 |
| 355 | Ga0466711_419724 | 3300042615 | Bacteria | 1301 |
| 356 | Ga0466718_065985 | 3300042617 | Bacteria | 7314 |
| 357 | Ga0466723_039429 | 3300042618 | Bacteria | 22952 |
| 358 | Ga0466726_380146 | 3300042619 | Bacteria | 11744 |
| 359 | Ga0466690_147457 | 3300042590 | Bacteria | 20788 |
| 360 | Ga0466693_004119 | 3300042592 | Unclassified | 1461 |
| 361 | Ga0466696_024699 | 3300042596 | Bacteria | 2734 |
| 362 | Ga0466699_080730 | 3300042597 | Bacteria | 1348 |
| 363 | 2227543243 | 2225789004 | Unclassified | 2959 |
| 364 | 2227591299 | 2225789004 | Bacteria | 12952 |
| 365 | IMNBL1DRAFT_c0018665 | 3300000062 | Bacteria | 2873 |
| 366 | AustNasuHG_c1010775 | 3300000089 | Unclassified | 3178 |
| 367 | JGI24695J34938_10311664 | 3300002450 | Unclassified | 682 |
| 368 | JGI24702J35022_10013656 | 3300002462 | Bacteria | 4493 |
| 369 | JGI24705J35276_12000420 | 3300002504 | Bacteria | 848 |
| 370 | JGI24696J40584_12959935 | 3300002834 | Bacteria | 5928 |
| 371 | Ga0068302_10554904 | 3300005071 | Bacteria | 2114 |
| 372 | Ga0466705_177763 | 3300042612 | Bacteria | 16760 |
| 373 | Ga0466705_244035 | 3300042612 | Bacteria | 1204 |
| 374 | Ga0466705_360346 | 3300042612 | Bacteria | 2414 |
| 375 | Ga0466705_375982 | 3300042612 | Bacteria | 18700 |
| 376 | Ga0466733_091171 | 3300042659 | Bacteria | 20195 |
| 377 | Ga0466706_023621 | 3300042599 | Unclassified | 3906 |
| 378 | Ga0466706_236050 | 3300042599 | Bacteria | 32404 |
| 379 | Ga0466706_271594 | 3300042599 | Bacteria | 2680 |
| 380 | Ga0466707_089699 | 3300042601 | Bacteria | 1501 |
| 381 | Ga0466707_158030 | 3300042601 | Bacteria | 1019 |
| 382 | Ga0466707_264961 | 3300042601 | Unclassified | 1168 |
| 383 | Ga0466714_167360 | 3300042603 | Bacteria | 1399 |
| 384 | Ga0466717_229602 | 3300042604 | Bacteria | 1436 |
| 385 | Ga0466716_512486 | 3300042605 | Unclassified | 1445 |
| 386 | Ga0466719_109561 | 3300042606 | Bacteria | 6891 |
| 387 | Ga0466722_163845 | 3300042609 | Bacteria | 26139 |
| 388 | Ga0466722_245127 | 3300042609 | Bacteria | 32663 |
| 389 | Ga0123357_10873610 | 3300009784 | Bacteria | 588 |
| 390 | Ga0123355_10001203 | 3300009826 | Bacteria | 36038 |
| 391 | Ga0123355_10002018 | 3300009826 | Bacteria | 28705 |
| 392 | Ga0123355_10035326 | 3300009826 | Bacteria | 8124 |
| 393 | Ga0123355_10060210 | 3300009826 | Bacteria | 6132 |
| 394 | Ga0123355_10258252 | 3300009826 | Unclassified | 2441 |
| 395 | Ga0123355_10284472 | 3300009826 | Bacteria | 2278 |
| 396 | Ga0123355_10598661 | 3300009826 | Unclassified | 1309 |
| 397 | Ga0123356_10061597 | 3300010049 | Bacteria | 3504 |
| 398 | Ga0123356_10076879 | 3300010049 | Bacteria | 3147 |
| 399 | Ga0123356_11315834 | 3300010049 | Unclassified | 885 |
| 400 | Ga0123356_11703413 | 3300010049 | Unclassified | 782 |
| 401 | Ga0123356_12410356 | 3300010049 | Unclassified | 658 |
| 402 | Ga0123356_12584436 | 3300010049 | Unclassified | 636 |
| 403 | Ga0123353_10007996 | 3300010167 | Bacteria | 14385 |
| 404 | Ga0123353_10036709 | 3300010167 | Bacteria | 7679 |
| 405 | Ga0123353_10070317 | 3300010167 | Bacteria | 5623 |
| 406 | Ga0123353_10125241 | 3300010167 | Bacteria | 4129 |
| 407 | Ga0123353_10220356 | 3300010167 | Bacteria | 2967 |
| 408 | Ga0123353_10462727 | 3300010167 | Bacteria | 1863 |
| 409 | Ga0123353_10586599 | 3300010167 | Unclassified | 1597 |
| 410 | Ga0123353_10746889 | 3300010167 | Unclassified | 1363 |
| 411 | Ga0123353_11164025 | 3300010167 | Unclassified | 1016 |
| 412 | Ga0123353_11342865 | 3300010167 | Unclassified | 924 |
| 413 | Ga0123354_10420706 | 3300010882 | Bacteria | 1110 |
| 414 | Ga0160464_100436 | 3300012805 | Bacteria | 31613 |
| 415 | Ga0466731_261831 | 3300042622 | Bacteria | 1483 |
| 416 | Ga0466704_276791 | 3300042643 | Unclassified | 4325 |
| 417 | Ga0466708_029631 | 3300042652 | Bacteria | 12490 |
| 418 | Ga0466708_107903 | 3300042652 | Bacteria | 16519 |
| 419 | Ga0466705_469506 | 3300042612 | Bacteria | 1036 |
| 420 | Ga0466711_262023 | 3300042615 | Bacteria | 25985 |
| 421 | Ga0466711_283812 | 3300042615 | Bacteria | 3229 |
| 422 | Ga0466715_051595 | 3300042616 | Unclassified | 5724 |
| 423 | Ga0466715_339223 | 3300042616 | Bacteria | 59419 |
| 424 | Ga0466723_302750 | 3300042618 | Bacteria | 42513 |
| 425 | Ga0466726_048826 | 3300042619 | Bacteria | 24055 |
| 426 | Ga0466726_244051 | 3300042619 | Bacteria | 1559 |
| 427 | Ga0466728_439396 | 3300042620 | Bacteria | 2474 |
| 428 | Ga0466656_122617 | 3300042550 | Bacteria | 4572 |
| 429 | Ga0466656_188917 | 3300042550 | Bacteria | 2437 |
| 430 | Ga0466692_026254 | 3300042591 | Bacteria | 97091 |
| 431 | Ga0466692_086953 | 3300042591 | Bacteria | 3810 |
| 432 | Ga0466694_060344 | 3300042594 | Unclassified | 1272 |
| 433 | Ga0466696_023405 | 3300042596 | Bacteria | 42390 |
| 434 | IMNBL1DRAFT_c0001685 | 3300000062 | Bacteria | 16309 |
| 435 | IMNBL1DRAFT_c0029228 | 3300000062 | Unclassified | 2042 |
| 436 | JGI24702J35022_10031983 | 3300002462 | Bacteria | 2818 |
| 437 | JGI24702J35022_10034668 | 3300002462 | Bacteria | 2699 |
| 438 | JGI24702J35022_10215933 | 3300002462 | Unclassified | 1103 |
| 439 | Ga0068302_10245003 | 3300005071 | Unclassified | 790 |
| 440 | Ga0466697_122055 | 3300042611 | Bacteria | 8875 |
| 441 | Ga0466697_146633 | 3300042611 | Bacteria | 3339 |
| 442 | Ga0466697_197377 | 3300042611 | Bacteria | 2320 |
| 443 | Ga0466706_113164 | 3300042599 | Bacteria | 25442 |
| 444 | Ga0466719_160142 | 3300042606 | Unclassified | 1281 |
| 445 | Ga0466719_161140 | 3300042606 | Bacteria | 1788 |
| 446 | Ga0466719_411407 | 3300042606 | Bacteria | 1881 |
| 447 | Ga0466722_167586 | 3300042609 | Bacteria | 2288 |
| 448 | Ga0123355_10421052 | 3300009826 | Unclassified | 1707 |
| 449 | Ga0123355_10757559 | 3300009826 | Unclassified | 1096 |
| 450 | Ga0123355_11286127 | 3300009826 | Unclassified | 736 |
| 451 | Ga0123356_10019723 | 3300010049 | Bacteria | 6390 |
| 452 | Ga0123356_10031451 | 3300010049 | Unclassified | 4966 |
| 453 | Ga0123356_10068223 | 3300010049 | Bacteria | 3331 |
| 454 | Ga0123356_10332092 | 3300010049 | Bacteria | 1637 |
| 455 | Ga0123356_11353523 | 3300010049 | Unclassified | 874 |
| 456 | Ga0123356_12100224 | 3300010049 | Bacteria | 705 |
| 457 | Ga0123356_13110924 | 3300010049 | Unclassified | 578 |
| 458 | Ga0123356_13689702 | 3300010049 | Unclassified | 529 |
| 459 | Ga0123356_14096702 | 3300010049 | Unclassified | 501 |
| 460 | Ga0123353_10005887 | 3300010167 | Bacteria | 16213 |
| 461 | Ga0123353_10007862 | 3300010167 | Bacteria | 14483 |
| 462 | Ga0123353_10044160 | 3300010167 | Bacteria | 7064 |
| 463 | Ga0123353_10049682 | 3300010167 | Bacteria | 6683 |
| 464 | Ga0123353_10055728 | 3300010167 | Bacteria | 6325 |
| 465 | Ga0123353_10068022 | 3300010167 | Unclassified | 5719 |
| 466 | Ga0123353_10148074 | 3300010167 | Bacteria | 3752 |
| 467 | Ga0123353_10194037 | 3300010167 | Unclassified | 3202 |
| 468 | Ga0123353_10253219 | 3300010167 | Bacteria | 2725 |
| 469 | Ga0123353_10257379 | 3300010167 | Bacteria | 2699 |
| 470 | Ga0123353_10437849 | 3300010167 | Unclassified | 1930 |
| 471 | Ga0123353_10688907 | 3300010167 | Bacteria | 1437 |
| 472 | Ga0123353_10722977 | 3300010167 | Bacteria | 1392 |
| 473 | Ga0123353_11228181 | 3300010167 | Bacteria | 981 |
| 474 | Ga0123353_11283688 | 3300010167 | Unclassified | 952 |
| 475 | Ga0123353_11319599 | 3300010167 | Unclassified | 935 |
| 476 | Ga0123354_10416351 | 3300010882 | Unclassified | 1121 |
| 477 | Ga0123354_10684427 | 3300010882 | Unclassified | 722 |
| 478 | Ga0466731_008549 | 3300042622 | Bacteria | 1664 |
| 479 | Ga0466731_065936 | 3300042622 | Bacteria | 20008 |
| 480 | Ga0466704_031146 | 3300042643 | Bacteria | 38318 |
| 481 | Ga0466705_498463 | 3300042612 | Bacteria | 6717 |
| 482 | Ga0466710_127144 | 3300042613 | Unclassified | 1420 |
| 483 | Ga0466711_047765 | 3300042615 | Bacteria | 35661 |
| 484 | Ga0466715_051700 | 3300042616 | Bacteria | 2899 |
| 485 | Ga0466715_245987 | 3300042616 | Bacteria | 9370 |
| 486 | Ga0466715_462559 | 3300042616 | Bacteria | 14908 |
| 487 | Ga0466723_281874 | 3300042618 | Unclassified | 2744 |
| 488 | Ga0466723_285463 | 3300042618 | Unclassified | 3710 |
| 489 | Ga0466723_337850 | 3300042618 | Bacteria | 3835 |
| 490 | Ga0466728_082463 | 3300042620 | Bacteria | 32980 |
| 491 | Ga0466657_337266 | 3300042582 | Bacteria | 1298 |
| 492 | Ga0466657_392797 | 3300042582 | Bacteria | 1004 |
| 493 | Ga0466692_130735 | 3300042591 | Bacteria | 26218 |
| 494 | Ga0466692_175666 | 3300042591 | Unclassified | 3239 |
| 495 | Ga0466693_018998 | 3300042592 | Unclassified | 1685 |
| 496 | Ga0466691_031002 | 3300042593 | Unclassified | 1573 |
| 497 | Ga0466691_140188 | 3300042593 | Bacteria | 4047 |
| 498 | Ga0466694_038466 | 3300042594 | Bacteria | 9857 |
| 499 | Ga0466694_362801 | 3300042594 | Bacteria | 11077 |
| 500 | Ga0466696_036667 | 3300042596 | Bacteria | 22217 |
| 501 | IMNBL1DRAFT_c0001208 | 3300000062 | Bacteria | 19538 |
| 502 | JGI24702J35022_10038653 | 3300002462 | Bacteria | 2547 |
| 503 | Ga0068305_10059300 | 3300005083 | Bacteria | 12379 |
| 504 | Ga0072940_1138387 | 3300005200 | Unclassified | 1018 |
| 505 | Ga0103265_1000005 | 3300007068 | Bacteria | 101135 |
| 506 | Ga0103267_1000251 | 3300007190 | Bacteria | 20440 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00416 | Ribosomal_S13 | Ribosomal protein S13/S18 | 28 | 134 | 0.99 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.