Protein Family IF06998

Metagenome Metatranscriptome Isolate
592 Members
160 Samples
506 Scaffolds
123.78 Avg Length

🧬 Representative Sequence

ID
3300042611|Ga0466697_106430|Ga0466697_106430_980_1432
Length
150 aa
Sequence
VKELLELFAAGIHVINRDREAGGNRMARIAGVDLPKDKRIEIALTYIFGIGLPTAKNILAKTGVNPDIRVKALSEEDAQKIRREIEENIKVEGDLRREISMSIKRLIDIGCYRGIRHKLGLPVRGQKTKTNARTRKGPRRTVANKKQAGK

πŸ“Š Sample Types

Isolate 14.5%
Metagenome 84.6%
MAG 0.0%
Metatranscriptome 0.8%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Unclassified 35.9%
Termitidae 25.6%
Blattidae 14.7%
Kalotermitidae 9.6%
Formicidae 2.6%
Termopsidae 2.6%
Rhinotermitidae 1.9%
Stratiomyidae 1.3%
Passalidae 1.3%
Tenebrionidae 0.6%
Hodotermitidae 0.6%
Armadillidiidae 0.6%
Scarabaeidae 0.6%
Apidae 0.6%
Noctuidae 0.6%
Drosophilidae 0.6%

🌳 Taxonomy

Archaea 0
Bacteria 397
Eukaryota 0
Viruses 0
Unclassified 195

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 2940221333 Paenibacillus sp. PastF-3 Isolate Blattidae
2 2940286528 Lachnospiraceae bacterium PFB1-21 Isolate Blattidae
3 2940425923 Paenibacillus sp. PastH-4 Isolate Blattidae
4 2820941830 Unclassified Actinobacteria Cu122P5bin49 Isolate Unclassified
5 2820220859 Unclassified Firmicutes Th196P4bin59 Isolate Unclassified
6 2820294436 Unclassified Firmicutes Th196P3bin104 Isolate Unclassified
7 2820312173 Unclassified Firmicutes Nt197P4bin8 Isolate Unclassified
8 2820321184 Unclassified Firmicutes Nt197P3bin86 Isolate Unclassified
9 2820371985 Unclassified Firmicutes Nt197P3bin100 Isolate Unclassified
10 2820391468 Unclassified Firmicutes Nc150P3bin1 Isolate Unclassified
11 2820451402 Unclassified Firmicutes Lab288P3bin174 Isolate Unclassified
12 8030343600 Proteiniborus sp. MB09-C3 Isolate Stratiomyidae
13 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
14 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
15 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
16 2983866074 Paenibacillus polymyxa A18 Isolate Unclassified
17 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
18 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
19 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
20 3300007188 Ant gut microbial communities from Cephalotes rohweri, Arizona, USA Metagenome Formicidae
21 3300022820 Termite gut microbial communities from Nasutitermes sp. nest - French Guiana - 36-11 mRNA Metatranscriptome Termitidae
22 2940292506 Lachnoclostridium sp. PH5-23 Isolate Blattidae
23 2940400224 Paenibacillus sp. PastM-2 Isolate Blattidae
24 2820238527 Unclassified Firmicutes Th196P3bin90 Isolate Unclassified
25 2820453354 Unclassified Firmicutes Lab288P3bin172 Isolate Unclassified
26 2820488713 Unclassified Firmicutes Lab288P1bin69 Isolate Unclassified
27 2820512088 Unclassified Firmicutes Lab288P1bin4 Isolate Unclassified
28 2820560510 Unclassified Firmicutes Emb289P3bin72 Isolate Unclassified
29 2820584674 Unclassified Firmicutes Emb289P1bin98 Isolate Unclassified
30 2820594669 Unclassified Firmicutes Emb289P1bin61 Isolate Unclassified
31 2820606014 Unclassified Firmicutes Emb289P1bin49 Isolate Unclassified
32 2820683647 Unclassified Firmicutes Co191P1bin82 Isolate Unclassified
33 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
34 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
35 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
36 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
37 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
38 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
39 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
40 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
41 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
42 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
43 2820921285 Unclassified Actinobacteria Emb289P3bin53 Isolate Unclassified
44 2940264388 Lachnospiraceae bacterium PFB1-17 Isolate Blattidae
45 2940267548 Lachnospiraceae bacterium PFB1-22 Isolate Blattidae
46 2940280053 Lachnospiraceae bacterium PF1-22 Isolate Blattidae
47 2940419646 Paenibacillus sp. PastF-4 Isolate Blattidae
48 2944625312 Dysgonomonas sp. PF1-3 Isolate Blattidae
49 2820813074 Unclassified Actinobacteria Nt197P3bin52 Isolate Unclassified
50 2585428085 Sporobacter termitidis DSM 10068 Isolate Termitidae
51 2820227065 Unclassified Firmicutes Th196P4bin44 Isolate Unclassified
52 2820254385 Unclassified Firmicutes Th196P3bin54 Isolate Unclassified
53 2820447167 Unclassified Firmicutes Lab288P3bin192 Isolate Unclassified
54 2820457604 Unclassified Firmicutes Lab288P3bin15 Isolate Unclassified
55 2820546020 Unclassified Firmicutes Lab288P1bin102 Isolate Unclassified
56 2820620956 Unclassified Firmicutes Emb289P1bin128 Isolate Unclassified
57 2820651690 Unclassified Firmicutes Cu122P3bin6 Isolate Unclassified
58 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
59 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
60 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
61 3300056564 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) Metagenome Tenebrionidae
62 8030337018 Tissierella sp. Yu-01 Isolate Stratiomyidae
63 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
64 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
65 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
66 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
67 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
68 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
69 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
70 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
71 3300007190 Ant gut microbial communities from Cephalotes umbraculatus, Peru Metagenome Formicidae
72 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
73 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
74 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
75 3300012829 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG Metagenome Armadillidiidae
76 2852337885 Paenibacillus protaetiae FW100M-2 Isolate Scarabaeidae
77 2940270707 Lachnoclostridium sp. PF1-13 Isolate Blattidae
78 2940380068 Paenibacillus sp. PastH-2 Isolate Blattidae
79 2940413413 Paenibacillus sp. PastH-3 Isolate Blattidae
80 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
81 2718218155 Flavobacteriaceae bacterium UJ101 Isolate
82 2820282995 Unclassified Firmicutes Th196P3bin147 Isolate Unclassified
83 2820314258 Unclassified Firmicutes Nt197P4bin16 Isolate Unclassified
84 2820340373 Unclassified Firmicutes Nt197P3bin67 Isolate Unclassified
85 2820400448 Unclassified Firmicutes Nc150Mbin1 Isolate Unclassified
86 3006461590 Streptomyces sp. RB5 Isolate Termitidae
87 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
88 3300012809 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E11 MG Metagenome
89 2820866620 Unclassified Actinobacteria Lab288P3bin139 Isolate Unclassified
90 2820906387 Unclassified Actinobacteria Emb289P4bin41 Isolate Unclassified
91 2940230426 Lachnospiraceae bacterium PH5-48 Isolate Blattidae
92 2940283334 Lachnospiraceae bacterium PF1-4 Isolate Blattidae
93 2940295490 Lachnospiraceae bacterium PH1-22 Isolate Blattidae
94 2940406939 Paenibacillus sp. PastM-3 Isolate Blattidae
95 2820280018 Unclassified Firmicutes Th196P3bin149 Isolate Unclassified
96 2820420508 Unclassified Firmicutes Lab288P3bin68 Isolate Unclassified
97 2820479655 Unclassified Firmicutes Lab288P1bin77 Isolate Unclassified
98 2820492969 Unclassified Firmicutes Lab288P1bin6 Isolate Unclassified
99 2820661146 Unclassified Firmicutes Co191P3bin61 Isolate Unclassified
100 2820705605 Unclassified Firmicutes Co191P1bin34 Isolate Unclassified
101 2820707375 Unclassified Firmicutes Co191P1bin31 Isolate Unclassified
102 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
103 651324002 Acetonema longum APO-1, DSM 6540 Isolate Kalotermitidae
104 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
105 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
106 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
107 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
108 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
109 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
110 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
111 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
112 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
113 2940277027 Lachnospiraceae bacterium PF1-21 Isolate Blattidae
114 2940386776 Paenibacillus sp. PastF-1 Isolate Blattidae
115 2820005795 Unclassified Synergistetes Nt197P3bin106 Isolate Unclassified
116 2820008971 Unclassified Synergistetes Lab288P3bin103 Isolate Unclassified
117 2820418027 Unclassified Firmicutes Lab288P3bin85 Isolate Unclassified
118 2820580397 Unclassified Firmicutes Emb289P3bin133 Isolate Unclassified
119 2820619171 Unclassified Firmicutes Emb289P1bin130 Isolate Unclassified
120 2820639607 Unclassified Firmicutes Cu122P5bin9 Isolate Unclassified
121 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
122 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
123 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
124 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
125 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
126 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
127 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
128 2971438493 Paenibacillus apiarius NRRL B-23460 Isolate Apidae
129 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
130 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
131 3300022232 Termite gut microbial communities from Cavitermes sp. nest - French Guiana - 28-9 mRNA Metatranscriptome Termitidae
132 2940233634 Lachnoclostridium sp. PF5-10 Isolate Blattidae
133 2940393498 Paenibacillus sp. PastF-2 Isolate Blattidae
134 2820244222 Unclassified Firmicutes Th196P3bin75 Isolate Unclassified
135 2820347164 Unclassified Firmicutes Nt197P3bin58 Isolate Unclassified
136 2820396902 Unclassified Firmicutes Nc150P1bin3 Isolate Unclassified
137 2820657860 Unclassified Firmicutes Co191P4bin15 Isolate Unclassified
138 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
139 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
140 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
141 3300007068 Ant gut microbial communities from Cephalotes simillimus, Peru Metagenome Formicidae
142 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
143 3300023282 Termite gut microbial communities from Aparatermes sp. nest - French Guiana - 29-3 mRNA Metatranscriptome Termitidae
144 2940273867 Lachnoclostridium sp. PH1-16 Isolate Blattidae
145 2940289514 Lachnospiraceae bacterium PM6-15 Isolate Blattidae
146 2551306396 Paenibacillus sp. ICGEB2008 Isolate Noctuidae
147 2576861701 Paenibacillus sp. JCM 10914 Isolate Termitidae
148 2820231849 Unclassified Firmicutes Th196P4bin1 Isolate Unclassified
149 2820324456 Unclassified Firmicutes Nt197P3bin80 Isolate Unclassified
150 2820690275 Unclassified Firmicutes Co191P1bin72 Isolate Unclassified
151 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
152 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
153 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
154 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
155 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
156 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
157 3300007129 Ant gut microbial communities from Cephalotes atratus, Brazil Metagenome Formicidae
158 3300007505 Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut Metagenome Drosophilidae
159 3300012805 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E11 MG Metagenome
160 3300021192 Termite gut microbial communities from nest - French Guiana - 5_4 mRNA SA Metatranscriptome Termitidae

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_206495 3300042612 Bacteria 9920
2 Ga0466706_064858 3300042599 Unclassified 2113
3 Ga0466706_269670 3300042599 Bacteria 79639
4 Ga0466707_159517 3300042601 Bacteria 2560
5 Ga0466707_243360 3300042601 Bacteria 29608
6 Ga0466713_025156 3300042602 Bacteria 41607
7 Ga0466713_050335 3300042602 Bacteria 1749
8 Ga0466719_047806 3300042606 Unclassified 1139
9 Ga0466719_146945 3300042606 Bacteria 1102
10 Ga0466719_221065 3300042606 Bacteria 6404
11 Ga0466719_395266 3300042606 Bacteria 3584
12 Ga0466721_100978 3300042608 Bacteria 228571
13 Ga0466722_221521 3300042609 Unclassified 30191
14 Ga0466698_337884 3300042610 Bacteria 12427
15 Ga0123355_10050135 3300009826 Bacteria 6785
16 Ga0123355_10315921 3300009826 Unclassified 2111
17 Ga0123355_11313960 3300009826 Unclassified 724
18 Ga0123356_10039435 3300010049 Bacteria 4400
19 Ga0123356_10054142 3300010049 Bacteria 3737
20 Ga0123356_10084927 3300010049 Unclassified 3001
21 Ga0123356_10397110 3300010049 Unclassified 1516
22 Ga0123356_10569360 3300010049 Unclassified 1295
23 Ga0123356_10751263 3300010049 Unclassified 1145
24 Ga0123356_10981126 3300010049 Unclassified 1015
25 Ga0123356_11121535 3300010049 Unclassified 954
26 Ga0123356_12490228 3300010049 Unclassified 648
27 Ga0123356_12498244 3300010049 Unclassified 647
28 Ga0123353_10059534 3300010167 Bacteria 6125
29 Ga0123353_10157516 3300010167 Unclassified 3618
30 Ga0123353_10244610 3300010167 Unclassified 2784
31 Ga0123353_10259943 3300010167 Unclassified 2682
32 Ga0123353_10634429 3300010167 Unclassified 1517
33 Ga0123353_10656207 3300010167 Unclassified 1484
34 Ga0123353_10676705 3300010167 Unclassified 1454
35 Ga0123353_10940538 3300010167 Unclassified 1170
36 Ga0123353_11303642 3300010167 Unclassified 943
37 Ga0123353_11529569 3300010167 Unclassified 848
38 Ga0466731_411781 3300042622 Unclassified 2526
39 Ga0466735_172128 3300042624 Unclassified 1606
40 Ga0466702_303103 3300042635 Bacteria 1353
41 Ga0466703_190986 3300042636 Bacteria 2102
42 Ga0466703_360640 3300042636 Bacteria 6191
43 Ga0466704_591951 3300042643 Unclassified 1325
44 Ga0466709_207118 3300042648 Bacteria 10221
45 Ga0466708_053951 3300042652 Bacteria 19818
46 Ga0466708_079679 3300042652 Bacteria 41277
47 Ga0466708_211226 3300042652 Unclassified 5754
48 Ga0466708_374147 3300042652 Bacteria 1751
49 Ga0466727_069506 3300042655 Bacteria 9138
50 Ga0466710_311945 3300042613 Unclassified 1220
51 Ga0466711_420482 3300042615 Bacteria 8461
52 Ga0466715_367868 3300042616 Bacteria 44460
53 Ga0466715_552404 3300042616 Bacteria 8959
54 Ga0466715_642022 3300042616 Bacteria 7468
55 Ga0466728_013154 3300042620 Bacteria 8447
56 Ga0255808_1001596 3300023282 Unclassified 969
57 Ga0415639_039146 3300038395 Bacteria 917
58 Ga0415639_109515 3300038395 Bacteria 1865
59 Ga0466657_053311 3300042582 Bacteria 1172
60 Ga0466696_176138 3300042596 Bacteria 8591
61 Ga0466696_445560 3300042596 Unclassified 2608
62 Ga0466699_302977 3300042597 Unclassified 3092
63 2227173319 2225789004 Bacteria 1516
64 2227473062 2225789004 Unclassified 908
65 IMNBL1DRAFT_c0003001 3300000062 Bacteria 11181
66 IMNBL1DRAFT_c0037293 3300000062 Bacteria 1686
67 JGI24702J35022_10000321 3300002462 Bacteria 28517
68 JGI24702J35022_10001245 3300002462 Bacteria 15858
69 JGI24702J35022_10097911 3300002462 Unclassified 1602
70 JGI24705J35276_12233870 3300002504 Bacteria 5119
71 Ga0068305_10018402 3300005083 Bacteria 2369
72 Ga0068305_10310197 3300005083 Bacteria 2518
73 Ga0072940_1093076 3300005200 Unclassified 1402
74 Ga0072940_1216662 3300005200 Bacteria 1501
75 Ga0072940_1336217 3300005200 Unclassified 936
76 Ga0466697_175772 3300042611 Unclassified 1380
77 Ga0466705_115618 3300042612 Bacteria 24638
78 Ga0466733_090281 3300042659 Bacteria 1022
79 Ga0466701_081443 3300042598 Unclassified 1542
80 Ga0466706_047158 3300042599 Bacteria 6142
81 Ga0466707_005722 3300042601 Bacteria 1697
82 Ga0466707_422369 3300042601 Bacteria 1614
83 Ga0466717_134450 3300042604 Unclassified 1998
84 Ga0466721_145693 3300042608 Bacteria 1883
85 Ga0466722_035400 3300042609 Bacteria 82053
86 Ga0466698_422804 3300042610 Bacteria 1213
87 Ga0123355_10437759 3300009826 Unclassified 1658
88 Ga0123355_11411973 3300009826 Unclassified 687
89 Ga0123355_11869642 3300009826 Unclassified 563
90 Ga0123356_10031697 3300010049 Bacteria 4946
91 Ga0123356_10049207 3300010049 Bacteria 3924
92 Ga0123356_10437465 3300010049 Unclassified 1453
93 Ga0123356_10497271 3300010049 Unclassified 1375
94 Ga0123356_10647498 3300010049 Unclassified 1224
95 Ga0123353_10000031 3300010167 Bacteria 160211
96 Ga0123353_10014428 3300010167 Bacteria 11391
97 Ga0123353_10047420 3300010167 Bacteria 6833
98 Ga0123353_10113684 3300010167 Bacteria 4358
99 Ga0123353_10130818 3300010167 Bacteria 4027
100 Ga0123353_10278501 3300010167 Unclassified 2571
101 Ga0123353_10327724 3300010167 Bacteria 2320
102 Ga0123353_10614066 3300010167 Unclassified 1550
103 Ga0123353_10695307 3300010167 Bacteria 1429
104 Ga0123353_10990994 3300010167 Unclassified 1130
105 Ga0123353_11987738 3300010167 Unclassified 713
106 Ga0123353_12136463 3300010167 Unclassified 680
107 Ga0123354_10282940 3300010882 Bacteria 1606
108 Ga0123354_10409023 3300010882 Unclassified 1140
109 Ga0160466_100720 3300012809 Bacteria 13535
110 Ga0466735_186546 3300042624 Bacteria 2719
111 Ga0466730_003828 3300042625 Bacteria 1004
112 Ga0466702_083701 3300042635 Unclassified 1740
113 Ga0466702_340988 3300042635 Bacteria 1757
114 Ga0466703_034881 3300042636 Bacteria 18131
115 Ga0466715_043804 3300042616 Bacteria 8517
116 Ga0466723_262454 3300042618 Bacteria 1367
117 Ga0466723_348088 3300042618 Bacteria 31343
118 Ga0466726_051866 3300042619 Bacteria 8985
119 Ga0466726_191343 3300042619 Bacteria 2509
120 Ga0466726_380315 3300042619 Bacteria 17436
121 Ga0222432_1016633 3300021192 Bacteria 924
122 Ga0466657_214154 3300042582 Bacteria 2521
123 Ga0466690_052764 3300042590 Bacteria 15693
124 Ga0466690_070620 3300042590 Unclassified 1805
125 Ga0466696_054148 3300042596 Bacteria 3103
126 2227358603 2225789004 Unclassified 6116
127 2227505172 2225789004 Bacteria 19004
128 IMNBL1DRAFT_c0000019 3300000062 Bacteria 170255
129 IMNBL1DRAFT_c0018360 3300000062 Bacteria 2912
130 IMNBL1DRAFT_c0174954 3300000062 Unclassified 544
131 JGI24695J34938_10057492 3300002450 Unclassified 1671
132 JGI24702J35022_10114863 3300002462 Unclassified 1482
133 JGI24702J35022_10207853 3300002462 Unclassified 1123
134 JGI24702J35022_10717071 3300002462 Unclassified 622
135 Ga0072941_1305479 3300005201 Bacteria 1399
136 Ga0103264_1000100 3300007188 Bacteria 49857
137 Ga0466697_106430 3300042611 Bacteria 2288
138 Ga0466697_125654 3300042611 Bacteria 6128
139 Ga0466705_079320 3300042612 Bacteria 80574
140 Ga0530661_000260 3300056564 Unclassified 42338
141 Ga0466706_223170 3300042599 Bacteria 11130
142 Ga0466707_041118 3300042601 Bacteria 16787
143 Ga0466707_375112 3300042601 Bacteria 17480
144 Ga0466714_161914 3300042603 Bacteria 1975
145 Ga0466714_169031 3300042603 Bacteria 152952
146 Ga0466717_133371 3300042604 Unclassified 1235
147 Ga0466717_228710 3300042604 Unclassified 1436
148 Ga0466716_003820 3300042605 Bacteria 11944
149 Ga0466716_462042 3300042605 Bacteria 1873
150 Ga0466719_030580 3300042606 Bacteria 1074
151 Ga0123357_10227153 3300009784 Bacteria 2055
152 Ga0123355_10200728 3300009826 Unclassified 2914
153 Ga0123355_10579663 3300009826 Unclassified 1342
154 Ga0123355_11541626 3300009826 Unclassified 645
155 Ga0123356_10011608 3300010049 Bacteria 8584
156 Ga0123356_10066070 3300010049 Bacteria 3385
157 Ga0123356_10126607 3300010049 Bacteria 2495
158 Ga0123356_10345524 3300010049 Bacteria 1610
159 Ga0123356_10720776 3300010049 Unclassified 1167
160 Ga0123356_12681653 3300010049 Unclassified 624
161 Ga0123356_13000839 3300010049 Unclassified 589
162 Ga0123353_10086758 3300010167 Bacteria 5041
163 Ga0123353_10349101 3300010167 Bacteria 2230
164 Ga0123353_10731328 3300010167 Unclassified 1382
165 Ga0123353_10812576 3300010167 Unclassified 1289
166 Ga0123353_11182484 3300010167 Unclassified 1006
167 Ga0123353_11420484 3300010167 Unclassified 890
168 Ga0123353_11437081 3300010167 Unclassified 884
169 Ga0123353_11694831 3300010167 Unclassified 792
170 Ga0123353_12120901 3300010167 Unclassified 683
171 Ga0123353_12781602 3300010167 Bacteria 574
172 Ga0123354_10018677 3300010882 Bacteria 10878
173 Ga0123354_10060354 3300010882 Bacteria 5611
174 Ga0123354_10364930 3300010882 Bacteria 1268
175 Ga0466731_312270 3300042622 Bacteria 2718
176 Ga0466734_167367 3300042623 Unclassified 2090
177 Ga0466703_241993 3300042636 Bacteria 19818
178 Ga0466704_116527 3300042643 Unclassified 2068
179 Ga0466708_076108 3300042652 Bacteria 112124
180 Ga0466708_274375 3300042652 Bacteria 21022
181 Ga0466727_011350 3300042655 Unclassified 1618
182 Ga0466705_496890 3300042612 Unclassified 4973
183 Ga0466705_519658 3300042612 Bacteria 15800
184 Ga0466710_226748 3300042613 Unclassified 2123
185 Ga0466711_169486 3300042615 Bacteria 18240
186 Ga0466723_149172 3300042618 Bacteria 10747
187 Ga0466723_173974 3300042618 Bacteria 14831
188 Ga0466723_254809 3300042618 Bacteria 13413
189 Ga0466723_259805 3300042618 Bacteria 11102
190 Ga0160467_100322 3300012829 Bacteria 52269
191 Ga0255809_1069686 3300022820 Bacteria 1864
192 Ga0466692_150758 3300042591 Unclassified 2245
193 Ga0466693_115745 3300042592 Bacteria 8780
194 Ga0466691_015234 3300042593 Bacteria 46974
195 Ga0466691_048716 3300042593 Bacteria 16548
196 Ga0466691_056146 3300042593 Bacteria 34897
197 Ga0466691_171488 3300042593 Bacteria 19589
198 Ga0466694_207338 3300042594 Bacteria 4989
199 Ga0466696_146079 3300042596 Unclassified 1618
200 Ga0466696_230686 3300042596 Unclassified 4092
201 Ga0466696_297061 3300042596 Bacteria 8630
202 2227263570 2225789004 Unclassified 1294
203 JGI24702J35022_10000420 3300002462 Bacteria 25476
204 JGI24705J35276_12238163 3300002504 Bacteria 16705
205 JGI24699J35502_10638993 3300002509 Bacteria 712
206 JGI24696J40584_12942121 3300002834 Bacteria 1730
207 Ga0068305_10178722 3300005083 Bacteria 13191
208 Ga0466697_184941 3300042611 Bacteria 1881
209 Ga0466705_146538 3300042612 Bacteria 158344
210 Ga0466705_160225 3300042612 Bacteria 45310
211 Ga0466706_133678 3300042599 Bacteria 1217
212 Ga0466700_102688 3300042600 Unclassified 1464
213 Ga0466714_014154 3300042603 Bacteria 4661
214 Ga0466719_263003 3300042606 Bacteria 4933
215 Ga0466721_015423 3300042608 Bacteria 14106
216 Ga0466721_204804 3300042608 Bacteria 2938
217 Ga0466722_033664 3300042609 Bacteria 51377
218 Ga0466722_035291 3300042609 Bacteria 6346
219 Ga0123357_10040183 3300009784 Unclassified 6362
220 Ga0123355_10036198 3300009826 Bacteria 8026
221 Ga0123355_10872459 3300009826 Unclassified 985
222 Ga0123355_11776769 3300009826 Unclassified 583
223 Ga0123356_10014493 3300010049 Bacteria 7579
224 Ga0123356_10167745 3300010049 Bacteria 2202
225 Ga0123356_10582417 3300010049 Unclassified 1282
226 Ga0123356_11097182 3300010049 Unclassified 964
227 Ga0123356_11256423 3300010049 Bacteria 905
228 Ga0123356_11596683 3300010049 Unclassified 807
229 Ga0123353_10000274 3300010167 Bacteria 64224
230 Ga0123353_10010432 3300010167 Bacteria 12954
231 Ga0123353_10199634 3300010167 Bacteria 3148
232 Ga0123353_10213427 3300010167 Bacteria 3025
233 Ga0123353_10666105 3300010167 Unclassified 1469
234 Ga0123353_11019394 3300010167 Bacteria 1110
235 Ga0123353_11928722 3300010167 Unclassified 727
236 Ga0123353_12238541 3300010167 Unclassified 660
237 Ga0123353_12678791 3300010167 Unclassified 588
238 Ga0466731_286467 3300042622 Bacteria 3189
239 Ga0466704_124543 3300042643 Bacteria 11491
240 Ga0466709_277451 3300042648 Unclassified 1293
241 Ga0466725_065787 3300042654 Bacteria 3634
242 Ga0466725_438936 3300042654 Unclassified 1626
243 Ga0466710_403640 3300042613 Bacteria 6861
244 Ga0466711_202977 3300042615 Bacteria 8125
245 Ga0466715_082070 3300042616 Unclassified 2270
246 Ga0466723_322684 3300042618 Bacteria 3300
247 Ga0466728_136371 3300042620 Unclassified 1349
248 Ga0466728_181136 3300042620 Bacteria 1719
249 Ga0466728_238217 3300042620 Unclassified 2195
250 Ga0466729_036937 3300042621 Unclassified 5877
251 Ga0233288_1088084 3300022232 Unclassified 991
252 Ga0255809_1010056 3300022820 Unclassified 1365
253 Ga0466690_387239 3300042590 Unclassified 2588
254 Ga0466693_412844 3300042592 Unclassified 1041
255 IMNBL1DRAFT_c0064593 3300000062 Unclassified 1083
256 JGI24702J35022_10000691 3300002462 Bacteria 20609
257 JGI24702J35022_10000871 3300002462 Bacteria 18695
258 Ga0072941_1289434 3300005201 Unclassified 1405
259 Ga0105005_1112256 3300007505 Unclassified 3998
260 Ga0466713_056349 3300042602 Bacteria 41260
261 Ga0466713_129420 3300042602 Unclassified 38326
262 Ga0466716_171481 3300042605 Bacteria 2188
263 Ga0466716_287106 3300042605 Bacteria 4411
264 Ga0466722_245949 3300042609 Unclassified 3016
265 Ga0466722_261327 3300042609 Bacteria 19029
266 Ga0123355_10005165 3300009826 Bacteria 19051
267 Ga0123355_10362529 3300009826 Unclassified 1908
268 Ga0123355_11625980 3300009826 Unclassified 621
269 Ga0123356_10033160 3300010049 Bacteria 4829
270 Ga0123356_10041987 3300010049 Bacteria 4262
271 Ga0123356_10412024 3300010049 Bacteria 1491
272 Ga0123356_10722472 3300010049 Bacteria 1166
273 Ga0123356_10987054 3300010049 Unclassified 1012
274 Ga0123356_11423205 3300010049 Bacteria 853
275 Ga0123353_10464820 3300010167 Unclassified 1857
276 Ga0123353_10709148 3300010167 Unclassified 1410
277 Ga0123353_10955818 3300010167 Unclassified 1158
278 Ga0123353_11173700 3300010167 Bacteria 1011
279 Ga0123353_11403875 3300010167 Unclassified 897
280 Ga0123353_13004456 3300010167 Bacteria 546
281 Ga0123354_10859187 3300010882 Unclassified 601
282 Ga0466729_310680 3300042621 Unclassified 1069
283 Ga0466734_129701 3300042623 Unclassified 1195
284 Ga0466704_173835 3300042643 Unclassified 1118
285 Ga0466704_430292 3300042643 Unclassified 2701
286 Ga0466725_190969 3300042654 Unclassified 1286
287 Ga0466727_142292 3300042655 Unclassified 4327
288 Ga0466727_280896 3300042655 Bacteria 3189
289 Ga0466711_214140 3300042615 Bacteria 14422
290 Ga0466711_301166 3300042615 Bacteria 1098
291 Ga0466711_511518 3300042615 Unclassified 1628
292 Ga0466715_116779 3300042616 Bacteria 15242
293 Ga0466715_374576 3300042616 Bacteria 3250
294 Ga0466718_065172 3300042617 Unclassified 1862
295 Ga0415639_001377 3300038395 Bacteria 23349
296 Ga0415639_006405 3300038395 Bacteria 33378
297 Ga0415639_019624 3300038395 Unclassified 2603
298 Ga0466690_392775 3300042590 Bacteria 4374
299 Ga0466691_201130 3300042593 Bacteria 16704
300 Ga0466694_021830 3300042594 Bacteria 15157
301 Ga0466696_172455 3300042596 Unclassified 1573
302 2227502504 2225789004 Unclassified 735
303 JGI24695J34938_10026103 3300002450 Bacteria 2780
304 JGI24695J34938_10051551 3300002450 Bacteria 1800
305 JGI24702J35022_10022324 3300002462 Bacteria 3426
306 JGI24702J35022_10386150 3300002462 Unclassified 843
307 Ga0068302_10023687 3300005071 Bacteria 8489
308 Ga0102734_1000004 3300007129 Bacteria 74698
309 Ga0466705_069841 3300042612 Bacteria 12967
310 Ga0466701_057656 3300042598 Unclassified 1626
311 Ga0466706_150029 3300042599 Bacteria 12161
312 Ga0466707_164538 3300042601 Bacteria 30398
313 Ga0466713_031263 3300042602 Unclassified 1347
314 Ga0466717_015734 3300042604 Bacteria 12599
315 Ga0466719_230029 3300042606 Bacteria 8834
316 Ga0466721_379250 3300042608 Unclassified 1174
317 Ga0123357_10752449 3300009784 Bacteria 677
318 Ga0123355_10000171 3300009826 Bacteria 79083
319 Ga0123355_10082782 3300009826 Bacteria 5117
320 Ga0123355_10513670 3300009826 Unclassified 1470
321 Ga0123355_10557290 3300009826 Bacteria 1382
322 Ga0123356_10002442 3300010049 Bacteria 19870
323 Ga0123356_10105118 3300010049 Unclassified 2716
324 Ga0123356_10244603 3300010049 Bacteria 1867
325 Ga0123356_10287420 3300010049 Unclassified 1743
326 Ga0123356_11072017 3300010049 Unclassified 975
327 Ga0123356_11101394 3300010049 Unclassified 962
328 Ga0123356_12093602 3300010049 Bacteria 706
329 Ga0123356_12105021 3300010049 Unclassified 705
330 Ga0123356_12218909 3300010049 Bacteria 686
331 Ga0123356_13010907 3300010049 Bacteria 588
332 Ga0123356_13199348 3300010049 Unclassified 570
333 Ga0123353_10008463 3300010167 Bacteria 14055
334 Ga0123353_10065327 3300010167 Bacteria 5841
335 Ga0123353_10476559 3300010167 Unclassified 1828
336 Ga0123353_10543589 3300010167 Unclassified 1678
337 Ga0123353_10565144 3300010167 Bacteria 1636
338 Ga0123353_11409835 3300010167 Unclassified 895
339 Ga0123353_11774704 3300010167 Unclassified 768
340 Ga0123354_10437287 3300010882 Unclassified 1071
341 Ga0123354_10471916 3300010882 Unclassified 999
342 Ga0466734_000776 3300042623 Unclassified 3159
343 Ga0466702_037397 3300042635 Unclassified 1158
344 Ga0466703_158678 3300042636 Unclassified 4260
345 Ga0466703_205940 3300042636 Bacteria 26157
346 Ga0466704_092701 3300042643 Bacteria 9103
347 Ga0466709_009067 3300042648 Bacteria 2740
348 Ga0466709_384402 3300042648 Bacteria 15155
349 Ga0466708_053272 3300042652 Bacteria 23559
350 Ga0466708_448160 3300042652 Unclassified 8446
351 Ga0466705_403255 3300042612 Bacteria 37741
352 Ga0466710_164580 3300042613 Bacteria 2243
353 Ga0466711_158351 3300042615 Bacteria 17441
354 Ga0466711_404513 3300042615 Unclassified 3530
355 Ga0466711_419724 3300042615 Bacteria 1301
356 Ga0466718_065985 3300042617 Bacteria 7314
357 Ga0466723_039429 3300042618 Bacteria 22952
358 Ga0466726_380146 3300042619 Bacteria 11744
359 Ga0466690_147457 3300042590 Bacteria 20788
360 Ga0466693_004119 3300042592 Unclassified 1461
361 Ga0466696_024699 3300042596 Bacteria 2734
362 Ga0466699_080730 3300042597 Bacteria 1348
363 2227543243 2225789004 Unclassified 2959
364 2227591299 2225789004 Bacteria 12952
365 IMNBL1DRAFT_c0018665 3300000062 Bacteria 2873
366 AustNasuHG_c1010775 3300000089 Unclassified 3178
367 JGI24695J34938_10311664 3300002450 Unclassified 682
368 JGI24702J35022_10013656 3300002462 Bacteria 4493
369 JGI24705J35276_12000420 3300002504 Bacteria 848
370 JGI24696J40584_12959935 3300002834 Bacteria 5928
371 Ga0068302_10554904 3300005071 Bacteria 2114
372 Ga0466705_177763 3300042612 Bacteria 16760
373 Ga0466705_244035 3300042612 Bacteria 1204
374 Ga0466705_360346 3300042612 Bacteria 2414
375 Ga0466705_375982 3300042612 Bacteria 18700
376 Ga0466733_091171 3300042659 Bacteria 20195
377 Ga0466706_023621 3300042599 Unclassified 3906
378 Ga0466706_236050 3300042599 Bacteria 32404
379 Ga0466706_271594 3300042599 Bacteria 2680
380 Ga0466707_089699 3300042601 Bacteria 1501
381 Ga0466707_158030 3300042601 Bacteria 1019
382 Ga0466707_264961 3300042601 Unclassified 1168
383 Ga0466714_167360 3300042603 Bacteria 1399
384 Ga0466717_229602 3300042604 Bacteria 1436
385 Ga0466716_512486 3300042605 Unclassified 1445
386 Ga0466719_109561 3300042606 Bacteria 6891
387 Ga0466722_163845 3300042609 Bacteria 26139
388 Ga0466722_245127 3300042609 Bacteria 32663
389 Ga0123357_10873610 3300009784 Bacteria 588
390 Ga0123355_10001203 3300009826 Bacteria 36038
391 Ga0123355_10002018 3300009826 Bacteria 28705
392 Ga0123355_10035326 3300009826 Bacteria 8124
393 Ga0123355_10060210 3300009826 Bacteria 6132
394 Ga0123355_10258252 3300009826 Unclassified 2441
395 Ga0123355_10284472 3300009826 Bacteria 2278
396 Ga0123355_10598661 3300009826 Unclassified 1309
397 Ga0123356_10061597 3300010049 Bacteria 3504
398 Ga0123356_10076879 3300010049 Bacteria 3147
399 Ga0123356_11315834 3300010049 Unclassified 885
400 Ga0123356_11703413 3300010049 Unclassified 782
401 Ga0123356_12410356 3300010049 Unclassified 658
402 Ga0123356_12584436 3300010049 Unclassified 636
403 Ga0123353_10007996 3300010167 Bacteria 14385
404 Ga0123353_10036709 3300010167 Bacteria 7679
405 Ga0123353_10070317 3300010167 Bacteria 5623
406 Ga0123353_10125241 3300010167 Bacteria 4129
407 Ga0123353_10220356 3300010167 Bacteria 2967
408 Ga0123353_10462727 3300010167 Bacteria 1863
409 Ga0123353_10586599 3300010167 Unclassified 1597
410 Ga0123353_10746889 3300010167 Unclassified 1363
411 Ga0123353_11164025 3300010167 Unclassified 1016
412 Ga0123353_11342865 3300010167 Unclassified 924
413 Ga0123354_10420706 3300010882 Bacteria 1110
414 Ga0160464_100436 3300012805 Bacteria 31613
415 Ga0466731_261831 3300042622 Bacteria 1483
416 Ga0466704_276791 3300042643 Unclassified 4325
417 Ga0466708_029631 3300042652 Bacteria 12490
418 Ga0466708_107903 3300042652 Bacteria 16519
419 Ga0466705_469506 3300042612 Bacteria 1036
420 Ga0466711_262023 3300042615 Bacteria 25985
421 Ga0466711_283812 3300042615 Bacteria 3229
422 Ga0466715_051595 3300042616 Unclassified 5724
423 Ga0466715_339223 3300042616 Bacteria 59419
424 Ga0466723_302750 3300042618 Bacteria 42513
425 Ga0466726_048826 3300042619 Bacteria 24055
426 Ga0466726_244051 3300042619 Bacteria 1559
427 Ga0466728_439396 3300042620 Bacteria 2474
428 Ga0466656_122617 3300042550 Bacteria 4572
429 Ga0466656_188917 3300042550 Bacteria 2437
430 Ga0466692_026254 3300042591 Bacteria 97091
431 Ga0466692_086953 3300042591 Bacteria 3810
432 Ga0466694_060344 3300042594 Unclassified 1272
433 Ga0466696_023405 3300042596 Bacteria 42390
434 IMNBL1DRAFT_c0001685 3300000062 Bacteria 16309
435 IMNBL1DRAFT_c0029228 3300000062 Unclassified 2042
436 JGI24702J35022_10031983 3300002462 Bacteria 2818
437 JGI24702J35022_10034668 3300002462 Bacteria 2699
438 JGI24702J35022_10215933 3300002462 Unclassified 1103
439 Ga0068302_10245003 3300005071 Unclassified 790
440 Ga0466697_122055 3300042611 Bacteria 8875
441 Ga0466697_146633 3300042611 Bacteria 3339
442 Ga0466697_197377 3300042611 Bacteria 2320
443 Ga0466706_113164 3300042599 Bacteria 25442
444 Ga0466719_160142 3300042606 Unclassified 1281
445 Ga0466719_161140 3300042606 Bacteria 1788
446 Ga0466719_411407 3300042606 Bacteria 1881
447 Ga0466722_167586 3300042609 Bacteria 2288
448 Ga0123355_10421052 3300009826 Unclassified 1707
449 Ga0123355_10757559 3300009826 Unclassified 1096
450 Ga0123355_11286127 3300009826 Unclassified 736
451 Ga0123356_10019723 3300010049 Bacteria 6390
452 Ga0123356_10031451 3300010049 Unclassified 4966
453 Ga0123356_10068223 3300010049 Bacteria 3331
454 Ga0123356_10332092 3300010049 Bacteria 1637
455 Ga0123356_11353523 3300010049 Unclassified 874
456 Ga0123356_12100224 3300010049 Bacteria 705
457 Ga0123356_13110924 3300010049 Unclassified 578
458 Ga0123356_13689702 3300010049 Unclassified 529
459 Ga0123356_14096702 3300010049 Unclassified 501
460 Ga0123353_10005887 3300010167 Bacteria 16213
461 Ga0123353_10007862 3300010167 Bacteria 14483
462 Ga0123353_10044160 3300010167 Bacteria 7064
463 Ga0123353_10049682 3300010167 Bacteria 6683
464 Ga0123353_10055728 3300010167 Bacteria 6325
465 Ga0123353_10068022 3300010167 Unclassified 5719
466 Ga0123353_10148074 3300010167 Bacteria 3752
467 Ga0123353_10194037 3300010167 Unclassified 3202
468 Ga0123353_10253219 3300010167 Bacteria 2725
469 Ga0123353_10257379 3300010167 Bacteria 2699
470 Ga0123353_10437849 3300010167 Unclassified 1930
471 Ga0123353_10688907 3300010167 Bacteria 1437
472 Ga0123353_10722977 3300010167 Bacteria 1392
473 Ga0123353_11228181 3300010167 Bacteria 981
474 Ga0123353_11283688 3300010167 Unclassified 952
475 Ga0123353_11319599 3300010167 Unclassified 935
476 Ga0123354_10416351 3300010882 Unclassified 1121
477 Ga0123354_10684427 3300010882 Unclassified 722
478 Ga0466731_008549 3300042622 Bacteria 1664
479 Ga0466731_065936 3300042622 Bacteria 20008
480 Ga0466704_031146 3300042643 Bacteria 38318
481 Ga0466705_498463 3300042612 Bacteria 6717
482 Ga0466710_127144 3300042613 Unclassified 1420
483 Ga0466711_047765 3300042615 Bacteria 35661
484 Ga0466715_051700 3300042616 Bacteria 2899
485 Ga0466715_245987 3300042616 Bacteria 9370
486 Ga0466715_462559 3300042616 Bacteria 14908
487 Ga0466723_281874 3300042618 Unclassified 2744
488 Ga0466723_285463 3300042618 Unclassified 3710
489 Ga0466723_337850 3300042618 Bacteria 3835
490 Ga0466728_082463 3300042620 Bacteria 32980
491 Ga0466657_337266 3300042582 Bacteria 1298
492 Ga0466657_392797 3300042582 Bacteria 1004
493 Ga0466692_130735 3300042591 Bacteria 26218
494 Ga0466692_175666 3300042591 Unclassified 3239
495 Ga0466693_018998 3300042592 Unclassified 1685
496 Ga0466691_031002 3300042593 Unclassified 1573
497 Ga0466691_140188 3300042593 Bacteria 4047
498 Ga0466694_038466 3300042594 Bacteria 9857
499 Ga0466694_362801 3300042594 Bacteria 11077
500 Ga0466696_036667 3300042596 Bacteria 22217
501 IMNBL1DRAFT_c0001208 3300000062 Bacteria 19538
502 JGI24702J35022_10038653 3300002462 Bacteria 2547
503 Ga0068305_10059300 3300005083 Bacteria 12379
504 Ga0072940_1138387 3300005200 Unclassified 1018
505 Ga0103265_1000005 3300007068 Bacteria 101135
506 Ga0103267_1000251 3300007190 Bacteria 20440

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00416 Ribosomal_S13 Ribosomal protein S13/S18 28 134 0.99

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.