Protein Family IF06990
Metagenome
Isolate
286
Members
86
Samples
247
Scaffolds
252
Avg Length
Representative Sequence
- ID
- 3300042611|Ga0466697_088530|Ga0466697_088530_344_1207
- Length
- 287 aa
- Sequence
- MVRINEQMLVKSPPVGDLGGFRAVIVEDEIIAAQNLQRLIAQINKDIEIIAILQSVEDSFEWFSLNPNPDLVFMDIHLSDGSSFSIFEKVKIHAPVIFTTAYDEYALKAFEVNSIDYLLKPINIKELERAIEKFSHFNKTHSSTTLTNQTQYPSNEEVIANMLSMLKKEKKVYKSYFLIPHKDRFIPLSVNDIAYIYSENKIAKIVTFDNRTYYENSSLDEIQRQIDPVKLFRANRQFIIAHKAIKDIAVWFDSKLSVNLTVAIPEKIIVSRTRASEFKAWYTEKKK
Sample Types
Isolate
13.3%
Metagenome
86.7%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
29.6%
Blattidae
28.4%
Kalotermitidae
17.3%
Unclassified
9.9%
Rhinotermitidae
4.9%
Termopsidae
3.7%
Passalidae
2.5%
Armadillidiidae
2.5%
Hodotermitidae
1.2%
Taxonomy
Archaea
0
Bacteria
280
Eukaryota
0
Viruses
0
Unclassified
6
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 2 | 2695420931 | Dysgonomonas macrotermitis DSM 27370 | Isolate | Unclassified |
| 3 | 2896330536 | Sphingobacterium sp. xlx-96 | Isolate | |
| 4 | 2940205530 | Parabacteroides sp. PH5-33 | Isolate | Blattidae |
| 5 | 2940216256 | Dysgonomonadaceae bacterium PH5-43 | Isolate | Blattidae |
| 6 | 2940317558 | Parabacteroides sp. PH5-26 | Isolate | Blattidae |
| 7 | 2940325180 | Parabacteroides sp. PH5-41 | Isolate | Blattidae |
| 8 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 9 | 3300012819 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E11 MG | Metagenome | Armadillidiidae |
| 10 | 2940212447 | Parabacteroides sp. PH5-16 | Isolate | Blattidae |
| 11 | 2940302308 | Parabacteroides sp. PF5-5 | Isolate | Blattidae |
| 12 | 2940321370 | Parabacteroides sp. PH5-39 | Isolate | Blattidae |
| 13 | 2940332795 | Parabacteroides sp. PH5-8 | Isolate | Blattidae |
| 14 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 15 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 16 | 3300012847 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG | Metagenome | Armadillidiidae |
| 17 | 8100166142 | Dysgonomonas sp. GY75 | Isolate | Rhinotermitidae |
| 18 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 19 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 20 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 21 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 22 | 2896321640 | Sphingobacterium sp. xlx-130 | Isolate | |
| 23 | 2940313741 | Parabacteroides sp. PH5-17 | Isolate | Blattidae |
| 24 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 25 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 26 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 27 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 28 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 29 | 2820770630 | Unclassified Bacteroidetes Lab288P3bin130 | Isolate | Unclassified |
| 30 | 2910959314 | Dysgonomonas sp. 511 | Isolate | Blattidae |
| 31 | 2923982719 | Parabacteroides sp. 52 | Isolate | Blattidae |
| 32 | 2940306115 | Parabacteroides sp. PFB2-22 | Isolate | Blattidae |
| 33 | 2940309933 | Parabacteroides sp. PH5-13 | Isolate | Blattidae |
| 34 | 2940328985 | Parabacteroides sp. PH5-46 | Isolate | Blattidae |
| 35 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 36 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 37 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 38 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 39 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 40 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 41 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 42 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 43 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 44 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 45 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 46 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 47 | 2820772500 | Unclassified Bacteroidetes Lab288P1bin72 | Isolate | Unclassified |
| 48 | 2940346213 | Parabacteroides sp. PFB2-12 | Isolate | Blattidae |
| 49 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 50 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 51 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 52 | 2820797595 | Unclassified Bacteroidetes Co191P3bin3 | Isolate | Unclassified |
| 53 | 2896350215 | Sphingobacterium sp. xlx-183 | Isolate | |
| 54 | 2910926975 | Dysgonomonas sp. 25 | Isolate | Blattidae |
| 55 | 2940195863 | Parabacteroides sp. PF5-6 | Isolate | Blattidae |
| 56 | 2940209341 | Parabacteroides sp. PFB2-10 | Isolate | Blattidae |
| 57 | 2940298504 | Parabacteroides sp. PF5-13 | Isolate | Blattidae |
| 58 | 3004667792 | Bacteroides sp. 519 | Isolate | Blattidae |
| 59 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 60 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 61 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 62 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 63 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 64 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 65 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 66 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 67 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 68 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 69 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 70 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 71 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 72 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 73 | 2820757377 | Unclassified Bacteroidetes Mp193P4bin6 | Isolate | Unclassified |
| 74 | 2898741527 | Sphingobacterium sp. xlx-73 | Isolate | |
| 75 | 2940199050 | Parabacteroides sp. PM6-13 | Isolate | Blattidae |
| 76 | 2940202316 | Parabacteroides sp. PF5-9 | Isolate | Blattidae |
| 77 | 2940371297 | Parabacteroides sp. PM5-20 | Isolate | Blattidae |
| 78 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 79 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 80 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 81 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 82 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 83 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 84 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 85 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 86 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466697_144082 | 3300042611 | Bacteria | 2115 |
| 2 | Ga0466697_211933 | 3300042611 | Bacteria | 12508 |
| 3 | Ga0466735_050877 | 3300042624 | Unclassified | 5723 |
| 4 | Ga0466703_372075 | 3300042636 | Bacteria | 10378 |
| 5 | Ga0466704_248984 | 3300042643 | Bacteria | 7531 |
| 6 | Ga0466708_000881 | 3300042652 | Bacteria | 14731 |
| 7 | Ga0466708_019575 | 3300042652 | Unclassified | 1664 |
| 8 | Ga0466725_001380 | 3300042654 | Bacteria | 1544 |
| 9 | Ga0123355_10044435 | 3300009826 | Bacteria | 7232 |
| 10 | Ga0123356_10068780 | 3300010049 | Bacteria | 3319 |
| 11 | Ga0466690_128413 | 3300042590 | Bacteria | 8934 |
| 12 | Ga0466692_198726 | 3300042591 | Bacteria | 9425 |
| 13 | Ga0466691_019248 | 3300042593 | Bacteria | 19420 |
| 14 | Ga0466696_185064 | 3300042596 | Bacteria | 9456 |
| 15 | Ga0466710_428921 | 3300042613 | Bacteria | 4030 |
| 16 | Ga0466711_168631 | 3300042615 | Bacteria | 7430 |
| 17 | Ga0466707_237357 | 3300042601 | Bacteria | 23620 |
| 18 | Ga0466707_237777 | 3300042601 | Bacteria | 5618 |
| 19 | Ga0466716_365193 | 3300042605 | Bacteria | 5819 |
| 20 | Ga0466719_004987 | 3300042606 | Bacteria | 6373 |
| 21 | Ga0466722_022157 | 3300042609 | Bacteria | 77437 |
| 22 | Ga0466722_075036 | 3300042609 | Bacteria | 7708 |
| 23 | IMNBL1DRAFT_c0027495 | 3300000062 | Bacteria | 2138 |
| 24 | JGI24702J35022_10018155 | 3300002462 | Bacteria | 3838 |
| 25 | Ga0068305_10136157 | 3300005083 | Bacteria | 4231 |
| 26 | Ga0466705_011060 | 3300042612 | Bacteria | 2618 |
| 27 | Ga0466733_018677 | 3300042659 | Bacteria | 2900 |
| 28 | Ga0466703_249699 | 3300042636 | Bacteria | 47455 |
| 29 | Ga0466703_263714 | 3300042636 | Bacteria | 11839 |
| 30 | Ga0466704_294751 | 3300042643 | Bacteria | 11001 |
| 31 | Ga0466704_317042 | 3300042643 | Bacteria | 8216 |
| 32 | Ga0466704_342268 | 3300042643 | Bacteria | 3130 |
| 33 | Ga0466709_064425 | 3300042648 | Bacteria | 43572 |
| 34 | Ga0466709_255776 | 3300042648 | Bacteria | 24169 |
| 35 | Ga0466708_108530 | 3300042652 | Bacteria | 10315 |
| 36 | Ga0466727_151686 | 3300042655 | Bacteria | 12362 |
| 37 | Ga0123357_10030261 | 3300009784 | Bacteria | 7340 |
| 38 | Ga0123357_10367731 | 3300009784 | Bacteria | 1352 |
| 39 | Ga0123353_10003337 | 3300010167 | Bacteria | 20256 |
| 40 | Ga0123353_10048477 | 3300010167 | Bacteria | 6764 |
| 41 | Ga0123353_10180524 | 3300010167 | Bacteria | 3342 |
| 42 | Ga0160468_100143 | 3300012819 | Bacteria | 66884 |
| 43 | Ga0466656_117438 | 3300042550 | Bacteria | 20246 |
| 44 | Ga0466696_428939 | 3300042596 | Bacteria | 2167 |
| 45 | Ga0466705_481418 | 3300042612 | Bacteria | 7027 |
| 46 | Ga0466710_234207 | 3300042613 | Bacteria | 1641 |
| 47 | Ga0466711_266669 | 3300042615 | Bacteria | 10291 |
| 48 | Ga0466715_036133 | 3300042616 | Bacteria | 9019 |
| 49 | Ga0466723_030006 | 3300042618 | Bacteria | 5586 |
| 50 | Ga0466723_257306 | 3300042618 | Bacteria | 6308 |
| 51 | Ga0466728_064502 | 3300042620 | Bacteria | 1473 |
| 52 | Ga0466728_422788 | 3300042620 | Bacteria | 1319 |
| 53 | Ga0466700_197306 | 3300042600 | Bacteria | 6844 |
| 54 | Ga0466707_408160 | 3300042601 | Bacteria | 1019 |
| 55 | Ga0466716_041307 | 3300042605 | Bacteria | 6429 |
| 56 | Ga0466719_315329 | 3300042606 | Bacteria | 1676 |
| 57 | Ga0466698_244215 | 3300042610 | Bacteria | 2610 |
| 58 | Ga0466697_056567 | 3300042611 | Bacteria | 485126 |
| 59 | 2227272457 | 2225789004 | Bacteria | 6880 |
| 60 | IMNBL1DRAFT_c0037356 | 3300000062 | Bacteria | 1684 |
| 61 | Ga0466705_028090 | 3300042612 | Bacteria | 2904 |
| 62 | Ga0466734_014107 | 3300042623 | Bacteria | 1319 |
| 63 | Ga0466735_071841 | 3300042624 | Bacteria | 2263 |
| 64 | Ga0466703_008994 | 3300042636 | Bacteria | 8245 |
| 65 | Ga0466703_057829 | 3300042636 | Bacteria | 6614 |
| 66 | Ga0466709_164079 | 3300042648 | Bacteria | 14559 |
| 67 | Ga0466709_240562 | 3300042648 | Bacteria | 4354 |
| 68 | Ga0466708_327998 | 3300042652 | Bacteria | 5555 |
| 69 | Ga0466727_089775 | 3300042655 | Bacteria | 10598 |
| 70 | Ga0466727_102378 | 3300042655 | Bacteria | 9872 |
| 71 | Ga0466727_254171 | 3300042655 | Bacteria | 5090 |
| 72 | Ga0123356_10143044 | 3300010049 | Bacteria | 2362 |
| 73 | Ga0123353_10078344 | 3300010167 | Bacteria | 5311 |
| 74 | Ga0123353_10206213 | 3300010167 | Bacteria | 3088 |
| 75 | Ga0123353_10842445 | 3300010167 | Bacteria | 1258 |
| 76 | Ga0123354_10001977 | 3300010882 | Bacteria | 26274 |
| 77 | Ga0123354_10375878 | 3300010882 | Bacteria | 1233 |
| 78 | Ga0466657_223027 | 3300042582 | Bacteria | 2505 |
| 79 | Ga0466657_227318 | 3300042582 | Bacteria | 10409 |
| 80 | Ga0466690_083927 | 3300042590 | Bacteria | 20212 |
| 81 | Ga0466691_083530 | 3300042593 | Bacteria | 8078 |
| 82 | Ga0466696_039324 | 3300042596 | Bacteria | 4246 |
| 83 | Ga0466696_042910 | 3300042596 | Bacteria | 2330 |
| 84 | Ga0466696_239216 | 3300042596 | Bacteria | 6186 |
| 85 | Ga0466715_016367 | 3300042616 | Bacteria | 26019 |
| 86 | Ga0466715_171782 | 3300042616 | Bacteria | 25470 |
| 87 | Ga0466723_057857 | 3300042618 | Bacteria | 2469 |
| 88 | Ga0466723_106728 | 3300042618 | Bacteria | 8787 |
| 89 | Ga0466723_305442 | 3300042618 | Bacteria | 3572 |
| 90 | Ga0466728_070800 | 3300042620 | Bacteria | 1841 |
| 91 | Ga0466706_113181 | 3300042599 | Bacteria | 2180 |
| 92 | Ga0466713_044431 | 3300042602 | Bacteria | 51121 |
| 93 | Ga0466713_076120 | 3300042602 | Bacteria | 2354 |
| 94 | Ga0466713_087512 | 3300042602 | Bacteria | 25471 |
| 95 | Ga0466713_090467 | 3300042602 | Bacteria | 29280 |
| 96 | Ga0466716_164163 | 3300042605 | Bacteria | 1132 |
| 97 | Ga0466719_002772 | 3300042606 | Bacteria | 5561 |
| 98 | Ga0466722_100226 | 3300042609 | Bacteria | 34191 |
| 99 | 2227236354 | 2225789004 | Bacteria | 7287 |
| 100 | IMNBL1DRAFT_c0003187 | 3300000062 | Bacteria | 10736 |
| 101 | JGI24702J35022_10015145 | 3300002462 | Bacteria | 4247 |
| 102 | Ga0072940_1234288 | 3300005200 | Bacteria | 3214 |
| 103 | Ga0072941_1091708 | 3300005201 | Bacteria | 7109 |
| 104 | Ga0466733_205011 | 3300042659 | Bacteria | 35496 |
| 105 | Ga0466731_281136 | 3300042622 | Bacteria | 2154 |
| 106 | Ga0466709_391166 | 3300042648 | Bacteria | 22805 |
| 107 | Ga0466708_205462 | 3300042652 | Bacteria | 7687 |
| 108 | Ga0123356_10192899 | 3300010049 | Bacteria | 2070 |
| 109 | Ga0123356_10576023 | 3300010049 | Bacteria | 1289 |
| 110 | Ga0123356_10675947 | 3300010049 | Bacteria | 1200 |
| 111 | Ga0123353_10074702 | 3300010167 | Bacteria | 5449 |
| 112 | Ga0123353_10161365 | 3300010167 | Bacteria | 3569 |
| 113 | Ga0466657_347806 | 3300042582 | Bacteria | 1072 |
| 114 | Ga0466657_377781 | 3300042582 | Bacteria | 3364 |
| 115 | Ga0466690_215992 | 3300042590 | Bacteria | 8237 |
| 116 | Ga0466692_048841 | 3300042591 | Bacteria | 12558 |
| 117 | Ga0466693_045324 | 3300042592 | Bacteria | 2320 |
| 118 | Ga0466696_342614 | 3300042596 | Bacteria | 2948 |
| 119 | Ga0466696_405556 | 3300042596 | Bacteria | 12219 |
| 120 | Ga0466723_137351 | 3300042618 | Bacteria | 4194 |
| 121 | Ga0466701_078019 | 3300042598 | Bacteria | 3142 |
| 122 | Ga0466713_048851 | 3300042602 | Bacteria | 6486 |
| 123 | Ga0466717_037630 | 3300042604 | Bacteria | 1135 |
| 124 | Ga0466719_401110 | 3300042606 | Bacteria | 1271 |
| 125 | Ga0466722_017632 | 3300042609 | Bacteria | 5211 |
| 126 | Ga0466697_038341 | 3300042611 | Bacteria | 1651 |
| 127 | 2227632951 | 2225789004 | Bacteria | 11318 |
| 128 | IMNBL1DRAFT_c0004577 | 3300000062 | Bacteria | 8243 |
| 129 | IMNBL1DRAFT_c0043550 | 3300000062 | Bacteria | 1485 |
| 130 | JGI24695J34938_10003465 | 3300002450 | Bacteria | 11006 |
| 131 | Ga0068305_10077318 | 3300005083 | Bacteria | 2630 |
| 132 | Ga0068305_10455320 | 3300005083 | Unclassified | 4117 |
| 133 | Ga0466705_145807 | 3300042612 | Bacteria | 26901 |
| 134 | Ga0466733_006757 | 3300042659 | Bacteria | 8323 |
| 135 | Ga0466735_101457 | 3300042624 | Unclassified | 1892 |
| 136 | Ga0466703_019771 | 3300042636 | Bacteria | 10207 |
| 137 | Ga0466709_114343 | 3300042648 | Bacteria | 85236 |
| 138 | Ga0466708_026623 | 3300042652 | Bacteria | 2928 |
| 139 | Ga0123353_10595075 | 3300010167 | Bacteria | 1582 |
| 140 | Ga0160445_100818 | 3300012847 | Bacteria | 11526 |
| 141 | Ga0160445_101301 | 3300012847 | Bacteria | 7382 |
| 142 | Ga0466690_199301 | 3300042590 | Bacteria | 6162 |
| 143 | Ga0466690_368465 | 3300042590 | Bacteria | 7757 |
| 144 | Ga0466691_108754 | 3300042593 | Bacteria | 2528 |
| 145 | Ga0466696_049113 | 3300042596 | Bacteria | 63300 |
| 146 | Ga0466696_124701 | 3300042596 | Bacteria | 3085 |
| 147 | Ga0466696_130780 | 3300042596 | Bacteria | 11111 |
| 148 | Ga0466711_022316 | 3300042615 | Bacteria | 5257 |
| 149 | Ga0466711_292014 | 3300042615 | Bacteria | 2097 |
| 150 | Ga0466728_327686 | 3300042620 | Bacteria | 44532 |
| 151 | Ga0466728_332223 | 3300042620 | Bacteria | 1323 |
| 152 | Ga0466706_008230 | 3300042599 | Bacteria | 32610 |
| 153 | Ga0466719_333891 | 3300042606 | Bacteria | 3898 |
| 154 | Ga0466719_425811 | 3300042606 | Bacteria | 1006 |
| 155 | Ga0466722_020936 | 3300042609 | Bacteria | 10136 |
| 156 | JGI24702J35022_10162139 | 3300002462 | Bacteria | 1260 |
| 157 | Ga0072941_1067624 | 3300005201 | Bacteria | 4779 |
| 158 | Ga0466735_026408 | 3300042624 | Bacteria | 1811 |
| 159 | Ga0466735_084845 | 3300042624 | Bacteria | 1153 |
| 160 | Ga0466709_267137 | 3300042648 | Bacteria | 107484 |
| 161 | Ga0466724_65742 | 3300042649 | Bacteria | 14284 |
| 162 | Ga0466708_090904 | 3300042652 | Bacteria | 64814 |
| 163 | Ga0466708_141133 | 3300042652 | Bacteria | 11097 |
| 164 | Ga0466725_103338 | 3300042654 | Bacteria | 13738 |
| 165 | Ga0466727_086906 | 3300042655 | Bacteria | 13101 |
| 166 | Ga0466727_254748 | 3300042655 | Bacteria | 6722 |
| 167 | Ga0466656_184113 | 3300042550 | Bacteria | 2295 |
| 168 | Ga0466690_186977 | 3300042590 | Bacteria | 11474 |
| 169 | Ga0466690_327831 | 3300042590 | Bacteria | 7007 |
| 170 | Ga0466692_203992 | 3300042591 | Unclassified | 1092 |
| 171 | Ga0466693_402693 | 3300042592 | Bacteria | 1664 |
| 172 | Ga0466696_296964 | 3300042596 | Bacteria | 6625 |
| 173 | Ga0466696_337103 | 3300042596 | Bacteria | 10251 |
| 174 | Ga0466712_314971 | 3300042614 | Bacteria | 8595 |
| 175 | Ga0466723_062363 | 3300042618 | Bacteria | 3765 |
| 176 | Ga0466723_234127 | 3300042618 | Bacteria | 12358 |
| 177 | Ga0466707_240692 | 3300042601 | Bacteria | 5512 |
| 178 | Ga0466713_027912 | 3300042602 | Bacteria | 47751 |
| 179 | Ga0466719_082201 | 3300042606 | Bacteria | 3178 |
| 180 | Ga0466722_163139 | 3300042609 | Bacteria | 3219 |
| 181 | IMNBL1DRAFT_c0001424 | 3300000062 | Bacteria | 17905 |
| 182 | JGI24699J35502_11134027 | 3300002509 | Bacteria | 24996 |
| 183 | Ga0068305_10259996 | 3300005083 | Bacteria | 4660 |
| 184 | Ga0466697_141273 | 3300042611 | Bacteria | 1253 |
| 185 | Ga0466729_285140 | 3300042621 | Bacteria | 9746 |
| 186 | Ga0466704_580358 | 3300042643 | Bacteria | 2595 |
| 187 | Ga0466709_334557 | 3300042648 | Bacteria | 43111 |
| 188 | Ga0466709_336610 | 3300042648 | Bacteria | 9072 |
| 189 | Ga0466708_098195 | 3300042652 | Bacteria | 3459 |
| 190 | Ga0123356_10058066 | 3300010049 | Bacteria | 3607 |
| 191 | Ga0123356_10529306 | 3300010049 | Bacteria | 1338 |
| 192 | Ga0123356_10569327 | 3300010049 | Bacteria | 1295 |
| 193 | Ga0123353_10078311 | 3300010167 | Unclassified | 5312 |
| 194 | Ga0123353_11139025 | 3300010167 | Bacteria | 1031 |
| 195 | Ga0123353_11308967 | 3300010167 | Bacteria | 940 |
| 196 | Ga0160445_100854 | 3300012847 | Bacteria | 11028 |
| 197 | Ga0466690_225246 | 3300042590 | Bacteria | 6354 |
| 198 | Ga0466710_144235 | 3300042613 | Bacteria | 4487 |
| 199 | Ga0466710_358330 | 3300042613 | Bacteria | 1070 |
| 200 | Ga0466715_403061 | 3300042616 | Bacteria | 5488 |
| 201 | Ga0466723_013630 | 3300042618 | Bacteria | 7358 |
| 202 | Ga0466728_107992 | 3300042620 | Bacteria | 3159 |
| 203 | Ga0466700_195714 | 3300042600 | Bacteria | 4794 |
| 204 | Ga0466713_048760 | 3300042602 | Bacteria | 2252 |
| 205 | Ga0466713_079790 | 3300042602 | Bacteria | 8736 |
| 206 | Ga0466716_087407 | 3300042605 | Bacteria | 4781 |
| 207 | Ga0466722_157787 | 3300042609 | Bacteria | 8128 |
| 208 | Ga0466697_002276 | 3300042611 | Bacteria | 2522 |
| 209 | IMNBL1DRAFT_c0000723 | 3300000062 | Bacteria | 26182 |
| 210 | IMNBL1DRAFT_c0020336 | 3300000062 | Bacteria | 2691 |
| 211 | JGI24702J35022_10026456 | 3300002462 | Bacteria | 3126 |
| 212 | Ga0466697_088530 | 3300042611 | Bacteria | 1320 |
| 213 | Ga0466697_162833 | 3300042611 | Bacteria | 2961 |
| 214 | Ga0466697_231270 | 3300042611 | Bacteria | 1146 |
| 215 | Ga0466705_379446 | 3300042612 | Bacteria | 13128 |
| 216 | Ga0466733_127177 | 3300042659 | Bacteria | 3589 |
| 217 | Ga0466735_132533 | 3300042624 | Bacteria | 2239 |
| 218 | Ga0466703_374672 | 3300042636 | Bacteria | 5746 |
| 219 | Ga0466704_061456 | 3300042643 | Bacteria | 2157 |
| 220 | Ga0466709_163107 | 3300042648 | Bacteria | 19592 |
| 221 | Ga0466725_010743 | 3300042654 | Bacteria | 1163 |
| 222 | Ga0123356_10115525 | 3300010049 | Bacteria | 2600 |
| 223 | Ga0123356_10529929 | 3300010049 | Bacteria | 1337 |
| 224 | Ga0123356_10678673 | 3300010049 | Bacteria | 1198 |
| 225 | Ga0123353_10000028 | 3300010167 | Bacteria | 164820 |
| 226 | Ga0466656_274956 | 3300042550 | Bacteria | 1580 |
| 227 | Ga0466691_076128 | 3300042593 | Bacteria | 5995 |
| 228 | Ga0466696_014598 | 3300042596 | Bacteria | 13177 |
| 229 | Ga0466696_188304 | 3300042596 | Bacteria | 24290 |
| 230 | Ga0466696_254689 | 3300042596 | Bacteria | 35518 |
| 231 | Ga0466696_399641 | 3300042596 | Bacteria | 27432 |
| 232 | Ga0466696_481263 | 3300042596 | Bacteria | 8007 |
| 233 | Ga0466696_481456 | 3300042596 | Bacteria | 8946 |
| 234 | Ga0466705_491628 | 3300042612 | Bacteria | 1884 |
| 235 | Ga0466710_131779 | 3300042613 | Bacteria | 9322 |
| 236 | Ga0466712_172894 | 3300042614 | Bacteria | 4506 |
| 237 | Ga0466723_006891 | 3300042618 | Bacteria | 31666 |
| 238 | Ga0466723_229815 | 3300042618 | Bacteria | 11904 |
| 239 | Ga0466707_060006 | 3300042601 | Bacteria | 6181 |
| 240 | Ga0466707_150724 | 3300042601 | Bacteria | 2496 |
| 241 | Ga0466707_221738 | 3300042601 | Bacteria | 26611 |
| 242 | Ga0466698_032096 | 3300042610 | Bacteria | 1071 |
| 243 | 2227493793 | 2225789004 | Bacteria | 4005 |
| 244 | IMNBL1DRAFT_c0008652 | 3300000062 | Bacteria | 5155 |
| 245 | IMNBL1DRAFT_c0023417 | 3300000062 | Bacteria | 2419 |
| 246 | Ga0068302_10112120 | 3300005071 | Bacteria | 2946 |
| 247 | Ga0068305_10065818 | 3300005083 | Bacteria | 10279 |
MSA Aligner
Functional Annotation
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF04397 | GO:0003677 | DNA binding | MF |
| PF00072 | GO:0000160 | phosphorelay signal transduction system | BP |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.