Protein Family IF06957
Metagenome
Isolate
189
Members
56
Samples
182
Scaffolds
270.6
Avg Length
Representative Sequence
- ID
- 3300042610|Ga0466698_399737|Ga0466698_399737_233_1123
- Length
- 296 aa
- Sequence
- LELPAAWKNVFHPENNMGDVQKTNPLSLIVMYAIVILFTLLAVYPIFWLIIQSFKTTQDYMLNSKLAFPVRWFFRNYPISWRTGRFSMLILNSIFYTSVTVVSIIILSFMAGFAFAKLPSKLTPILHGSFIIGILLTLQSILVPLFLMINATGLYNTRLGVLIPYIGIGLPFGIYLSTEYIKGIPDSVIESARIDGAKYLRIFRSIIMPIASPVAVTVAILSITGTWNEFMLINILVSKNELKSLPVGINMFSGALASDFGKQFAALVIGMTPMIIFYLIFRKRITEGVSAGAVKG
Sample Types
Isolate
3.7%
Metagenome
96.3%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
45.3%
Kalotermitidae
26.4%
Unclassified
15.1%
Rhinotermitidae
7.5%
Termopsidae
3.8%
Hodotermitidae
1.9%
Taxonomy
Archaea
0
Bacteria
173
Eukaryota
0
Viruses
0
Unclassified
16
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125651 | Treponema sp. Co191P3bin8 | Isolate | Unclassified |
| 2 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 3 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 4 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 5 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 6 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 7 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 8 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 9 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 10 | 650716102 | Treponema primitia ZAS-2 | Isolate | Unclassified |
| 11 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 12 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 13 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 14 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 15 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 16 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 17 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 18 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 19 | 3300002507 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 | Metagenome | Termitidae |
| 20 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 21 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 22 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 23 | 2781125687 | Treponema sp. Lab288P4bin29 | Isolate | Unclassified |
| 24 | 2781125696 | Treponema sp. Th196P4bin22 | Isolate | Unclassified |
| 25 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 26 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 27 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 28 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 29 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 30 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 31 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 32 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 33 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 34 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 35 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 36 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 37 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 38 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 39 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 40 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 41 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 42 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 43 | 2781125689 | Treponema sp. Mp193P4bin9 | Isolate | Unclassified |
| 44 | 3300001880 | Termite hindgut microbial communities from the Max Planck Institute, Bremen, Germany, analyzing fibers in the hindgut lumen - ASSEMBLED Fiber-Associated Metagenome | Metagenome | |
| 45 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 46 | 2781125634 | Treponema sp. Co191P1bin45 | Isolate | Unclassified |
| 47 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 48 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 49 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 50 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 51 | 2781125697 | Treponema sp. Th196P4bin17 | Isolate | Unclassified |
| 52 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 53 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 54 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 55 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 56 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466733_149869 | 3300042659 | Bacteria | 8387 |
| 2 | Ga0466706_160403 | 3300042599 | Bacteria | 2741 |
| 3 | Ga0466707_299843 | 3300042601 | Bacteria | 2821 |
| 4 | Ga0466722_016217 | 3300042609 | Bacteria | 6001 |
| 5 | Ga0466722_168172 | 3300042609 | Bacteria | 11643 |
| 6 | JGI24698J34947_10001108 | 3300002449 | Bacteria | 13893 |
| 7 | JGI24698J34947_10113697 | 3300002449 | Bacteria | 1189 |
| 8 | Ga0072940_1012970 | 3300005200 | Bacteria | 4554 |
| 9 | Ga0072941_1011361 | 3300005201 | Unclassified | 12960 |
| 10 | Ga0466705_430412 | 3300042612 | Bacteria | 8024 |
| 11 | Ga0466711_193435 | 3300042615 | Bacteria | 6203 |
| 12 | Ga0466718_051125 | 3300042617 | Bacteria | 2584 |
| 13 | Ga0466718_169367 | 3300042617 | Bacteria | 3306 |
| 14 | Ga0466726_345518 | 3300042619 | Bacteria | 5130 |
| 15 | Ga0264413_101054 | 3300024493 | Bacteria | 8808 |
| 16 | Ga0466694_123668 | 3300042594 | Bacteria | 5234 |
| 17 | Ga0466696_116969 | 3300042596 | Bacteria | 15796 |
| 18 | Ga0466696_138975 | 3300042596 | Bacteria | 11995 |
| 19 | Ga0466696_320714 | 3300042596 | Bacteria | 5700 |
| 20 | Ga0466699_007467 | 3300042597 | Bacteria | 1680 |
| 21 | Ga0123355_10377151 | 3300009826 | Bacteria | 1852 |
| 22 | Ga0466704_477217 | 3300042643 | Unclassified | 3107 |
| 23 | Ga0466708_278449 | 3300042652 | Bacteria | 1659 |
| 24 | Ga0466727_051430 | 3300042655 | Bacteria | 4955 |
| 25 | Ga0466732_339398 | 3300042656 | Bacteria | 6768 |
| 26 | Ga0466720_115810 | 3300042607 | Bacteria | 4956 |
| 27 | Ga0466720_123370 | 3300042607 | Unclassified | 1873 |
| 28 | Ga0466722_081140 | 3300042609 | Bacteria | 1937 |
| 29 | Ga0466722_160996 | 3300042609 | Bacteria | 18974 |
| 30 | Ga0466698_073174 | 3300042610 | Bacteria | 1082 |
| 31 | Ga0466698_405094 | 3300042610 | Bacteria | 1013 |
| 32 | AustNasuHG_c1016683 | 3300000089 | Bacteria | 2451 |
| 33 | JGI24695J34938_10015390 | 3300002450 | Bacteria | 3926 |
| 34 | JGI24695J34938_10043288 | 3300002450 | Bacteria | 2010 |
| 35 | JGI24702J35022_10022212 | 3300002462 | Bacteria | 3437 |
| 36 | Ga0072940_1029704 | 3300005200 | Bacteria | 3870 |
| 37 | Ga0072941_1002224 | 3300005201 | Bacteria | 13116 |
| 38 | Ga0072941_1020810 | 3300005201 | Bacteria | 8497 |
| 39 | Ga0466705_124471 | 3300042612 | Bacteria | 5503 |
| 40 | Ga0466705_365475 | 3300042612 | Unclassified | 4239 |
| 41 | Ga0466723_316341 | 3300042618 | Bacteria | 37580 |
| 42 | Ga0466726_030432 | 3300042619 | Bacteria | 24294 |
| 43 | Ga0466726_492116 | 3300042619 | Bacteria | 1222 |
| 44 | Ga0466728_337747 | 3300042620 | Bacteria | 3381 |
| 45 | Ga0264413_111445 | 3300024493 | Bacteria | 14584 |
| 46 | Ga0466690_317756 | 3300042590 | Bacteria | 2185 |
| 47 | Ga0466692_140083 | 3300042591 | Bacteria | 1405 |
| 48 | Ga0466692_191616 | 3300042591 | Bacteria | 5418 |
| 49 | Ga0466691_144782 | 3300042593 | Bacteria | 35149 |
| 50 | Ga0466694_026216 | 3300042594 | Bacteria | 44731 |
| 51 | Ga0466694_112784 | 3300042594 | Bacteria | 5965 |
| 52 | Ga0466729_310769 | 3300042621 | Bacteria | 1383 |
| 53 | Ga0466704_222278 | 3300042643 | Bacteria | 19727 |
| 54 | Ga0466708_027263 | 3300042652 | Bacteria | 15744 |
| 55 | Ga0466708_079819 | 3300042652 | Bacteria | 8102 |
| 56 | Ga0466732_297193 | 3300042656 | Bacteria | 1498 |
| 57 | Ga0466717_124266 | 3300042604 | Bacteria | 1431 |
| 58 | Ga0466720_066785 | 3300042607 | Bacteria | 1630 |
| 59 | AustNasuHG_c1014616 | 3300000089 | Bacteria | 2663 |
| 60 | FAAS_10001194 | 3300001880 | Bacteria | 1316 |
| 61 | JGI24695J34938_10002921 | 3300002450 | Bacteria | 12393 |
| 62 | JGI24695J34938_10034526 | 3300002450 | Bacteria | 2320 |
| 63 | JGI24702J35022_10003924 | 3300002462 | Bacteria | 8934 |
| 64 | Ga0466705_258627 | 3300042612 | Bacteria | 11727 |
| 65 | Ga0466711_153381 | 3300042615 | Bacteria | 4299 |
| 66 | Ga0466715_233938 | 3300042616 | Bacteria | 9949 |
| 67 | Ga0466718_116625 | 3300042617 | Bacteria | 1304 |
| 68 | Ga0466726_252469 | 3300042619 | Bacteria | 3451 |
| 69 | Ga0466726_375182 | 3300042619 | Bacteria | 15101 |
| 70 | Ga0466728_115492 | 3300042620 | Bacteria | 18751 |
| 71 | Ga0466692_132530 | 3300042591 | Bacteria | 37722 |
| 72 | Ga0466694_204632 | 3300042594 | Bacteria | 1136 |
| 73 | Ga0466699_032243 | 3300042597 | Bacteria | 1531 |
| 74 | Ga0466703_135579 | 3300042636 | Bacteria | 3347 |
| 75 | Ga0466727_235174 | 3300042655 | Bacteria | 3608 |
| 76 | Ga0466719_057956 | 3300042606 | Bacteria | 5521 |
| 77 | Ga0466720_134722 | 3300042607 | Unclassified | 2349 |
| 78 | Ga0466722_049172 | 3300042609 | Bacteria | 5084 |
| 79 | AustNasuHG_c1022283 | 3300000089 | Bacteria | 2037 |
| 80 | Ga0072940_1013272 | 3300005200 | Bacteria | 4799 |
| 81 | Ga0072940_1048695 | 3300005200 | Bacteria | 4774 |
| 82 | Ga0072941_1079045 | 3300005201 | Bacteria | 4894 |
| 83 | Ga0074263_100055 | 3300005485 | Bacteria | 4319 |
| 84 | Ga0466718_050603 | 3300042617 | Bacteria | 8779 |
| 85 | Ga0466718_087308 | 3300042617 | Bacteria | 2122 |
| 86 | Ga0466726_416440 | 3300042619 | Bacteria | 3379 |
| 87 | Ga0264413_100669 | 3300024493 | Bacteria | 11782 |
| 88 | Ga0264413_103860 | 3300024493 | Bacteria | 1728 |
| 89 | Ga0456237_0004735 | 3300041968 | Bacteria | 2179 |
| 90 | Ga0466694_171604 | 3300042594 | Bacteria | 2147 |
| 91 | Ga0466695_009302 | 3300042595 | Bacteria | 3067 |
| 92 | Ga0466699_084347 | 3300042597 | Bacteria | 4286 |
| 93 | Ga0466707_100992 | 3300042601 | Bacteria | 1119 |
| 94 | Ga0466722_031182 | 3300042609 | Bacteria | 24727 |
| 95 | Ga0466722_076388 | 3300042609 | Bacteria | 12202 |
| 96 | Ga0466698_359291 | 3300042610 | Bacteria | 2415 |
| 97 | Ga0466698_399737 | 3300042610 | Bacteria | 1202 |
| 98 | JGI24698J34947_10004930 | 3300002449 | Bacteria | 7314 |
| 99 | Ga0074263_117579 | 3300005485 | Bacteria | 3473 |
| 100 | Ga0466712_038130 | 3300042614 | Bacteria | 20446 |
| 101 | Ga0466712_287775 | 3300042614 | Unclassified | 2124 |
| 102 | Ga0466711_168556 | 3300042615 | Bacteria | 55422 |
| 103 | Ga0466718_063445 | 3300042617 | Bacteria | 5746 |
| 104 | Ga0466718_161422 | 3300042617 | Bacteria | 1489 |
| 105 | Ga0466718_168645 | 3300042617 | Unclassified | 2932 |
| 106 | Ga0466723_136078 | 3300042618 | Unclassified | 3483 |
| 107 | Ga0466726_158587 | 3300042619 | Bacteria | 1283 |
| 108 | Ga0466729_081703 | 3300042621 | Bacteria | 4095 |
| 109 | Ga0264413_109002 | 3300024493 | Bacteria | 2681 |
| 110 | Ga0466690_082299 | 3300042590 | Bacteria | 4325 |
| 111 | Ga0466692_126050 | 3300042591 | Bacteria | 5112 |
| 112 | Ga0466696_099173 | 3300042596 | Bacteria | 2471 |
| 113 | Ga0466699_110972 | 3300042597 | Bacteria | 2115 |
| 114 | Ga0123357_10096099 | 3300009784 | Bacteria | 3838 |
| 115 | Ga0466703_103808 | 3300042636 | Bacteria | 65741 |
| 116 | Ga0466703_127939 | 3300042636 | Bacteria | 32645 |
| 117 | Ga0466704_491957 | 3300042643 | Unclassified | 16412 |
| 118 | Ga0466727_006127 | 3300042655 | Unclassified | 1483 |
| 119 | Ga0466706_195116 | 3300042599 | Bacteria | 1215 |
| 120 | Ga0466720_200781 | 3300042607 | Bacteria | 10651 |
| 121 | Ga0466698_168009 | 3300042610 | Bacteria | 41165 |
| 122 | AustNasuHG_c1019031 | 3300000089 | Bacteria | 2259 |
| 123 | JGI24698J34947_10079713 | 3300002449 | Bacteria | 1541 |
| 124 | JGI24699J35502_11119610 | 3300002509 | Bacteria | 3183 |
| 125 | Ga0072941_1023219 | 3300005201 | Bacteria | 4863 |
| 126 | Ga0466711_100751 | 3300042615 | Bacteria | 5891 |
| 127 | Ga0466715_178499 | 3300042616 | Bacteria | 3756 |
| 128 | Ga0466718_060989 | 3300042617 | Unclassified | 3908 |
| 129 | Ga0466726_166302 | 3300042619 | Bacteria | 4735 |
| 130 | Ga0466694_229662 | 3300042594 | Bacteria | 2102 |
| 131 | Ga0466699_257370 | 3300042597 | Bacteria | 15379 |
| 132 | Ga0466699_423054 | 3300042597 | Bacteria | 1385 |
| 133 | Ga0466703_046388 | 3300042636 | Bacteria | 22730 |
| 134 | Ga0466703_422496 | 3300042636 | Bacteria | 1451 |
| 135 | Ga0466709_127137 | 3300042648 | Bacteria | 4654 |
| 136 | Ga0466708_104918 | 3300042652 | Bacteria | 2222 |
| 137 | Ga0466732_206149 | 3300042656 | Bacteria | 1592 |
| 138 | Ga0466733_131762 | 3300042659 | Bacteria | 13323 |
| 139 | Ga0466707_095176 | 3300042601 | Bacteria | 6288 |
| 140 | Ga0466714_040238 | 3300042603 | Bacteria | 13182 |
| 141 | JGI24702J35022_10024968 | 3300002462 | Bacteria | 3227 |
| 142 | JGI24697J35500_11160685 | 3300002507 | Unclassified | 1400 |
| 143 | Ga0072940_1235995 | 3300005200 | Bacteria | 5744 |
| 144 | Ga0466705_507463 | 3300042612 | Bacteria | 1614 |
| 145 | Ga0466712_157243 | 3300042614 | Bacteria | 2042 |
| 146 | Ga0466715_524769 | 3300042616 | Bacteria | 17670 |
| 147 | Ga0466718_121786 | 3300042617 | Bacteria | 1811 |
| 148 | Ga0466726_243121 | 3300042619 | Bacteria | 2175 |
| 149 | Ga0466728_307899 | 3300042620 | Bacteria | 8199 |
| 150 | Ga0466694_169470 | 3300042594 | Bacteria | 10079 |
| 151 | Ga0466699_142247 | 3300042597 | Bacteria | 1628 |
| 152 | Ga0123353_10139590 | 3300010167 | Bacteria | 3883 |
| 153 | Ga0466704_357625 | 3300042643 | Bacteria | 5482 |
| 154 | Ga0466709_055220 | 3300042648 | Bacteria | 12997 |
| 155 | Ga0466732_116533 | 3300042656 | Bacteria | 17693 |
| 156 | Ga0466732_180358 | 3300042656 | Bacteria | 8804 |
| 157 | Ga0466716_338181 | 3300042605 | Unclassified | 3006 |
| 158 | Ga0466720_026033 | 3300042607 | Bacteria | 10333 |
| 159 | Ga0466720_066832 | 3300042607 | Bacteria | 7301 |
| 160 | Ga0466720_177676 | 3300042607 | Bacteria | 91443 |
| 161 | Ga0466705_186256 | 3300042612 | Bacteria | 7882 |
| 162 | Ga0466705_287101 | 3300042612 | Bacteria | 1981 |
| 163 | Ga0466718_054887 | 3300042617 | Bacteria | 4312 |
| 164 | Ga0466718_086776 | 3300042617 | Bacteria | 73105 |
| 165 | Ga0264413_101312 | 3300024493 | Unclassified | 1803 |
| 166 | Ga0264413_103379 | 3300024493 | Bacteria | 13508 |
| 167 | Ga0466692_068135 | 3300042591 | Bacteria | 6741 |
| 168 | Ga0466692_119438 | 3300042591 | Bacteria | 8628 |
| 169 | Ga0466694_056937 | 3300042594 | Bacteria | 11086 |
| 170 | Ga0466694_068198 | 3300042594 | Bacteria | 4530 |
| 171 | Ga0466694_094882 | 3300042594 | Bacteria | 23179 |
| 172 | Ga0466694_129519 | 3300042594 | Bacteria | 58319 |
| 173 | Ga0466696_329665 | 3300042596 | Bacteria | 5604 |
| 174 | Ga0466699_053666 | 3300042597 | Bacteria | 30730 |
| 175 | Ga0123355_10301200 | 3300009826 | Bacteria | 2185 |
| 176 | Ga0123353_10267239 | 3300010167 | Bacteria | 2638 |
| 177 | Ga0123354_10159503 | 3300010882 | Bacteria | 2686 |
| 178 | Ga0466729_205711 | 3300042621 | Bacteria | 1777 |
| 179 | Ga0466731_317119 | 3300042622 | Bacteria | 2529 |
| 180 | Ga0466704_055479 | 3300042643 | Bacteria | 4734 |
| 181 | Ga0466704_255539 | 3300042643 | Unclassified | 5126 |
| 182 | Ga0466727_141018 | 3300042655 | Unclassified | 4296 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00528 | BPD_transp_1 | Binding-protein-dependent transport system inner membrane component | 109 | 283 | 0.83 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.