Protein Family IF06927
Metagenome
Metatranscriptome
Isolate
245
Members
100
Samples
221
Scaffolds
126.64
Avg Length
Representative Sequence
- ID
- 3300042610|Ga0466698_049442|Ga0466698_049442_7279_7740
- Length
- 153 aa
- Sequence
- LQFVFAIEYFCKDFLILRRFFLPTINQLVRKGRKQVKTRSKTVALDQCPQKRGVCTRVFTTTPKKPNSALRKVARVRLSNQMEVNAYIPGEGHNLQEHSIVLVRGGRVKDVPGVRYHIIRGTLDTQGVADRKQGRSKYGAGKKSTAAATKKKK
Sample Types
Isolate
9.8%
Metagenome
88.6%
MAG
0.0%
Metatranscriptome
1.6%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
36.2%
Unclassified
22.3%
Kalotermitidae
16.0%
Formicidae
9.6%
Rhinotermitidae
3.2%
Termopsidae
3.2%
Passalidae
2.1%
Drosophilidae
2.1%
Hodotermitidae
1.1%
Culicidae
1.1%
Apidae
1.1%
Armadillidiidae
1.1%
Elmidae
1.1%
Taxonomy
Archaea
0
Bacteria
182
Eukaryota
0
Viruses
0
Unclassified
63
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820880921 | Unclassified Actinobacteria Lab288P1bin60 | Isolate | Unclassified |
| 2 | 2820934415 | Unclassified Actinobacteria Emb289P1bin68 | Isolate | Unclassified |
| 3 | 2687453753 | Burkholderiales bacterium B_Cag25 | Isolate | Unclassified |
| 4 | 2820136564 | Unclassified Proteobacteria Emb289P3bin18 | Isolate | Unclassified |
| 5 | 2820137450 | Unclassified Proteobacteria Emb289P3bin120 | Isolate | Unclassified |
| 6 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 7 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 8 | 3300002938 | Larval gut metagenome for colony PL005 | Metagenome | Formicidae |
| 9 | 3300022232 | Termite gut microbial communities from Cavitermes sp. nest - French Guiana - 28-9 mRNA | Metatranscriptome | Termitidae |
| 10 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 11 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 12 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 13 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 14 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 15 | 2503904012 | Sphaerochaeta coccoides SPN1, DSM 17374 | Isolate | Kalotermitidae |
| 16 | 2687453742 | Burkholderiales bacterium B_Cag20 | Isolate | Unclassified |
| 17 | 2778260940 | Unclassified Fibrobacteres Mp193P3bin36 | Isolate | Unclassified |
| 18 | 2820075487 | Unclassified Proteobacteria Nt197P3bin122 | Isolate | Unclassified |
| 19 | 2820647881 | Unclassified Firmicutes Cu122P5bin16 | Isolate | Unclassified |
| 20 | 2585427698 | Occidentia massiliensis OS118 | Isolate | Unclassified |
| 21 | 3300007083 | Ant gut microbial communities from Cephalotes persimilis, Brazil | Metagenome | Formicidae |
| 22 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 23 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 24 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 25 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 26 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 27 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 28 | 3300002934 | Ant worker gut metagenome for colony PL005 | Metagenome | Formicidae |
| 29 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 30 | 3300007052 | Ant gut microbial communities from Cephalotes eduarduli, Brazil | Metagenome | Formicidae |
| 31 | 3300007153 | Drosophila gut microbial communities from New York, USA - Drosophila putrida male 3 gut | Metagenome | Drosophilidae |
| 32 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 33 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 34 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 35 | 3300021237 | Termite gut microbial communities from nest from French Guiana -FG16_15_2 mRNA SA | Metatranscriptome | |
| 36 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 37 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 38 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 39 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 40 | 2931425734 | Nocardioides sp. J2M5 | Isolate | |
| 41 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 42 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 43 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 44 | 3300007188 | Ant gut microbial communities from Cephalotes rohweri, Arizona, USA | Metagenome | Formicidae |
| 45 | 3300012850 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E0 MG | Metagenome | Culicidae |
| 46 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 47 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 48 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 49 | 2886876212 | Tokpelaia sp. RhiAcro1 | Isolate | Formicidae |
| 50 | 2603880165 | Burkholderiales A1 | Isolate | Unclassified |
| 51 | 2740892547 | Fibrobacteria bacterium GUT77 MC_77 | Isolate | Unclassified |
| 52 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 53 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 54 | 3300007150 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 3 gut | Metagenome | Drosophilidae |
| 55 | 3300012814 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E6 MG | Metagenome | |
| 56 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 57 | 3300026559 | Army ant gut microbial communities from Eciton burchelli, Santa Rosa, Costa Rica - colony SREbp2 | Metagenome | Formicidae |
| 58 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 59 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 60 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 61 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 62 | 2820939604 | Unclassified Actinobacteria Emb289P1bin4 | Isolate | Unclassified |
| 63 | 2773857778 | Unclassified Fibrobacteres Co191P1bin56 | Isolate | Unclassified |
| 64 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 65 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 66 | 3300001880 | Termite hindgut microbial communities from the Max Planck Institute, Bremen, Germany, analyzing fibers in the hindgut lumen - ASSEMBLED Fiber-Associated Metagenome | Metagenome | |
| 67 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 68 | 3300005721 | Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 | Metagenome | Apidae |
| 69 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 70 | 3300012820 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E6 MG | Metagenome | Armadillidiidae |
| 71 | 3300021231 | Termite gut microbial communities from nest - French Guiana - 10-1 mRNA SA | Metatranscriptome | Termitidae |
| 72 | 3300026545 | Army ant gut microbial communities from Eciton burchelli, Santa Rosa, Costa Rica - colony SREbp1 | Metagenome | Formicidae |
| 73 | 2864937364 | Acidovorax soli S00198 | Isolate | Elmidae |
| 74 | 2778260935 | Unclassified Fibrobacteres Co191P1bin79 | Isolate | Unclassified |
| 75 | 2778260938 | Unclassified Fibrobacteres Co191P3bin71 | Isolate | Unclassified |
| 76 | 2820744581 | Unclassified Bacteroidetes Th196P3bin138 | Isolate | Unclassified |
| 77 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 78 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 79 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 80 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 81 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 82 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 83 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 84 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 85 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 86 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 87 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 88 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 89 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 90 | 2778260936 | Unclassified Fibrobacteres Co191P3bin13 | Isolate | Unclassified |
| 91 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 92 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 93 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 94 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 95 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 96 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 97 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 98 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 99 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 100 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466733_029380 | 3300042659 | Bacteria | 41262 |
| 2 | Ga0160453_101261 | 3300012814 | Bacteria | 9570 |
| 3 | Ga0466690_081991 | 3300042590 | Bacteria | 1064 |
| 4 | Ga0466693_068379 | 3300042592 | Unclassified | 2689 |
| 5 | Ga0466691_203401 | 3300042593 | Bacteria | 20144 |
| 6 | Ga0466691_206626 | 3300042593 | Bacteria | 2592 |
| 7 | Ga0466696_398980 | 3300042596 | Bacteria | 15504 |
| 8 | Ga0123355_11515356 | 3300009826 | Unclassified | 653 |
| 9 | Ga0123353_10090826 | 3300010167 | Unclassified | 4919 |
| 10 | Ga0123353_10618103 | 3300010167 | Bacteria | 1543 |
| 11 | Ga0466701_051312 | 3300042598 | Bacteria | 1920 |
| 12 | Ga0466707_287674 | 3300042601 | Bacteria | 1251 |
| 13 | Ga0466717_286136 | 3300042604 | Unclassified | 2729 |
| 14 | Ga0466716_429562 | 3300042605 | Bacteria | 29095 |
| 15 | Ga0466719_483240 | 3300042606 | Bacteria | 1662 |
| 16 | JGI24698J34947_10124143 | 3300002449 | Unclassified | 1115 |
| 17 | JGI24695J34938_10000345 | 3300002450 | Bacteria | 45645 |
| 18 | JGI24702J35022_10409087 | 3300002462 | Bacteria | 820 |
| 19 | CVPL010W_10001647 | 3300002931 | Unclassified | 26264 |
| 20 | Ga0068305_10012178 | 3300005083 | Bacteria | 84311 |
| 21 | Ga0072940_1018708 | 3300005200 | Bacteria | 59155 |
| 22 | Ga0103261_1002614 | 3300007083 | Unclassified | 2828 |
| 23 | Ga0466705_400848 | 3300042612 | Bacteria | 43103 |
| 24 | Ga0466710_046595 | 3300042613 | Bacteria | 1990 |
| 25 | Ga0466710_152397 | 3300042613 | Unclassified | 2535 |
| 26 | Ga0466710_397392 | 3300042613 | Unclassified | 1663 |
| 27 | Ga0466728_091507 | 3300042620 | Bacteria | 35272 |
| 28 | Ga0466728_260117 | 3300042620 | Bacteria | 3894 |
| 29 | Ga0466728_403718 | 3300042620 | Unclassified | 2268 |
| 30 | Ga0466729_270949 | 3300042621 | Bacteria | 3547 |
| 31 | Ga0466703_021871 | 3300042636 | Bacteria | 36991 |
| 32 | Ga0466703_079639 | 3300042636 | Bacteria | 72500 |
| 33 | Ga0466709_405803 | 3300042648 | Bacteria | 16787 |
| 34 | Ga0223675_1015546 | 3300021237 | Unclassified | 693 |
| 35 | Ga0255575_1000336 | 3300026559 | Bacteria | 274913 |
| 36 | Ga0466696_050199 | 3300042596 | Bacteria | 2858 |
| 37 | Ga0123357_10028884 | 3300009784 | Bacteria | 7515 |
| 38 | Ga0123357_10071309 | 3300009784 | Bacteria | 4607 |
| 39 | Ga0123355_10876135 | 3300009826 | Unclassified | 982 |
| 40 | Ga0466707_074518 | 3300042601 | Bacteria | 1308 |
| 41 | Ga0466716_200811 | 3300042605 | Bacteria | 15529 |
| 42 | Ga0466719_288864 | 3300042606 | Bacteria | 1865 |
| 43 | JGI24696J40584_12462980 | 3300002834 | Unclassified | 581 |
| 44 | CVPL010W_10000688 | 3300002931 | Bacteria | 37286 |
| 45 | CVPL010W_10054855 | 3300002931 | Bacteria | 890 |
| 46 | Ga0072940_1265585 | 3300005200 | Bacteria | 1179 |
| 47 | Ga0104050_1012825 | 3300007153 | Unclassified | 1248 |
| 48 | Ga0466711_032192 | 3300042615 | Bacteria | 26652 |
| 49 | Ga0466715_105517 | 3300042616 | Bacteria | 4615 |
| 50 | Ga0466723_029277 | 3300042618 | Unclassified | 2444 |
| 51 | Ga0466702_018887 | 3300042635 | Bacteria | 1770 |
| 52 | Ga0466703_425526 | 3300042636 | Unclassified | 1537 |
| 53 | Ga0466725_450639 | 3300042654 | Unclassified | 1551 |
| 54 | Ga0466732_196753 | 3300042656 | Bacteria | 2402 |
| 55 | Ga0160434_122787 | 3300012850 | Unclassified | 939 |
| 56 | Ga0223682_1001894 | 3300021231 | Bacteria | 1062 |
| 57 | Ga0466690_196200 | 3300042590 | Unclassified | 2174 |
| 58 | Ga0466696_173253 | 3300042596 | Unclassified | 1400 |
| 59 | Ga0123355_10030305 | 3300009826 | Bacteria | 8767 |
| 60 | Ga0123355_10494993 | 3300009826 | Unclassified | 1512 |
| 61 | Ga0123355_10796077 | 3300009826 | Bacteria | 1055 |
| 62 | Ga0123356_10422232 | 3300010049 | Unclassified | 1476 |
| 63 | Ga0123356_10938265 | 3300010049 | Bacteria | 1036 |
| 64 | Ga0123353_10503901 | 3300010167 | Bacteria | 1763 |
| 65 | Ga0123353_10542276 | 3300010167 | Bacteria | 1680 |
| 66 | Ga0123353_11187236 | 3300010167 | Unclassified | 1003 |
| 67 | Ga0123354_10513824 | 3300010882 | Bacteria | 925 |
| 68 | Ga0466707_299691 | 3300042601 | Bacteria | 1030 |
| 69 | Ga0466716_065312 | 3300042605 | Bacteria | 35879 |
| 70 | Ga0466698_049442 | 3300042610 | Bacteria | 44660 |
| 71 | AustNasuHG_c1002181 | 3300000089 | Bacteria | 7083 |
| 72 | JGI24705J35276_12085646 | 3300002504 | Bacteria | 983 |
| 73 | JGI24705J35276_12228624 | 3300002504 | Unclassified | 3223 |
| 74 | JGI24705J35276_12232191 | 3300002504 | Bacteria | 4225 |
| 75 | Ga0072940_1196647 | 3300005200 | Bacteria | 4558 |
| 76 | Ga0104019_1002442 | 3300007150 | Bacteria | 6828 |
| 77 | Ga0103264_1000735 | 3300007188 | Bacteria | 15837 |
| 78 | Ga0103264_1004228 | 3300007188 | Bacteria | 6738 |
| 79 | Ga0466728_441888 | 3300042620 | Bacteria | 103256 |
| 80 | Ga0466731_036498 | 3300042622 | Bacteria | 4523 |
| 81 | Ga0466730_003020 | 3300042625 | Bacteria | 3396 |
| 82 | Ga0466703_348284 | 3300042636 | Bacteria | 9095 |
| 83 | Ga0466704_262692 | 3300042643 | Bacteria | 3036 |
| 84 | Ga0466704_297114 | 3300042643 | Unclassified | 10137 |
| 85 | Ga0466709_323155 | 3300042648 | Bacteria | 19411 |
| 86 | Ga0466705_226396 | 3300042612 | Bacteria | 7133 |
| 87 | Ga0466732_122054 | 3300042656 | Bacteria | 2206 |
| 88 | Ga0233288_1030220 | 3300022232 | Unclassified | 721 |
| 89 | Ga0415639_003422 | 3300038395 | Unclassified | 2021 |
| 90 | Ga0123355_10697409 | 3300009826 | Bacteria | 1167 |
| 91 | Ga0123356_10427215 | 3300010049 | Bacteria | 1468 |
| 92 | Ga0123353_10066716 | 3300010167 | Bacteria | 5777 |
| 93 | Ga0123353_10998447 | 3300010167 | Unclassified | 1125 |
| 94 | Ga0466706_054789 | 3300042599 | Bacteria | 17954 |
| 95 | Ga0466700_028309 | 3300042600 | Bacteria | 6884 |
| 96 | Ga0466719_003424 | 3300042606 | Unclassified | 8146 |
| 97 | Ga0466719_119617 | 3300042606 | Bacteria | 7324 |
| 98 | Ga0466719_285091 | 3300042606 | Bacteria | 30775 |
| 99 | Ga0466719_385821 | 3300042606 | Bacteria | 1758 |
| 100 | 2227527393 | 2225789004 | Bacteria | 16791 |
| 101 | IMNBL1DRAFT_c0037509 | 3300000062 | Bacteria | 1679 |
| 102 | CVPL005W_1002444 | 3300002934 | Unclassified | 3622 |
| 103 | Ga0072940_1295310 | 3300005200 | Unclassified | 747 |
| 104 | Ga0466723_149721 | 3300042618 | Unclassified | 9193 |
| 105 | Ga0466723_318553 | 3300042618 | Unclassified | 1245 |
| 106 | Ga0466726_482339 | 3300042619 | Unclassified | 1133 |
| 107 | Ga0466734_025870 | 3300042623 | Unclassified | 1133 |
| 108 | Ga0466734_075350 | 3300042623 | Unclassified | 2022 |
| 109 | Ga0466735_214017 | 3300042624 | Bacteria | 3755 |
| 110 | Ga0466703_068303 | 3300042636 | Bacteria | 34193 |
| 111 | Ga0466709_016875 | 3300042648 | Unclassified | 6874 |
| 112 | Ga0466727_225224 | 3300042655 | Bacteria | 1822 |
| 113 | Ga0466733_194513 | 3300042659 | Bacteria | 13688 |
| 114 | Ga0160456_100454 | 3300012820 | Bacteria | 13332 |
| 115 | Ga0466692_175558 | 3300042591 | Bacteria | 16086 |
| 116 | Ga0466693_070193 | 3300042592 | Bacteria | 6074 |
| 117 | Ga0466696_277781 | 3300042596 | Bacteria | 1922 |
| 118 | Ga0123357_10180824 | 3300009784 | Bacteria | 2463 |
| 119 | Ga0123357_10316080 | 3300009784 | Bacteria | 1551 |
| 120 | Ga0123356_10847856 | 3300010049 | Unclassified | 1085 |
| 121 | Ga0123356_11953716 | 3300010049 | Bacteria | 731 |
| 122 | Ga0123356_14110211 | 3300010049 | Unclassified | 501 |
| 123 | Ga0123353_10041577 | 3300010167 | Bacteria | 7263 |
| 124 | Ga0466701_016117 | 3300042598 | Unclassified | 1121 |
| 125 | Ga0466706_099297 | 3300042599 | Bacteria | 1770 |
| 126 | Ga0466700_073131 | 3300042600 | Bacteria | 2597 |
| 127 | Ga0466716_138410 | 3300042605 | Bacteria | 3571 |
| 128 | Ga0466716_451824 | 3300042605 | Unclassified | 1462 |
| 129 | Ga0466719_084177 | 3300042606 | Bacteria | 1058 |
| 130 | Ga0466721_394519 | 3300042608 | Bacteria | 3285 |
| 131 | Ga0466722_170339 | 3300042609 | Bacteria | 3474 |
| 132 | JGI24705J35276_12234103 | 3300002504 | Unclassified | 5255 |
| 133 | Ga0074278_128763 | 3300005721 | Bacteria | 16087 |
| 134 | Ga0102736_1004026 | 3300007052 | Unclassified | 2036 |
| 135 | Ga0466710_155272 | 3300042613 | Bacteria | 15343 |
| 136 | Ga0466711_327618 | 3300042615 | Bacteria | 4348 |
| 137 | Ga0466711_397767 | 3300042615 | Unclassified | 2261 |
| 138 | Ga0466715_269493 | 3300042616 | Bacteria | 7054 |
| 139 | Ga0466728_115181 | 3300042620 | Bacteria | 50250 |
| 140 | Ga0466731_033263 | 3300042622 | Bacteria | 1236 |
| 141 | Ga0466734_128711 | 3300042623 | Bacteria | 1264 |
| 142 | Ga0466724_00244 | 3300042649 | Bacteria | 17236 |
| 143 | Ga0466697_060039 | 3300042611 | Unclassified | 2165 |
| 144 | Ga0466733_210848 | 3300042659 | Bacteria | 1589 |
| 145 | Ga0466690_355929 | 3300042590 | Bacteria | 1833 |
| 146 | Ga0466691_074179 | 3300042593 | Bacteria | 55711 |
| 147 | Ga0466695_008516 | 3300042595 | Bacteria | 2536 |
| 148 | Ga0466695_177256 | 3300042595 | Bacteria | 3091 |
| 149 | Ga0466696_262377 | 3300042596 | Bacteria | 1115 |
| 150 | Ga0123355_10283126 | 3300009826 | Unclassified | 2286 |
| 151 | Ga0123355_10420295 | 3300009826 | Bacteria | 1709 |
| 152 | Ga0123356_10114745 | 3300010049 | Unclassified | 2609 |
| 153 | Ga0123353_10558588 | 3300010167 | Bacteria | 1649 |
| 154 | Ga0466706_006948 | 3300042599 | Bacteria | 3450 |
| 155 | Ga0466706_182787 | 3300042599 | Bacteria | 29721 |
| 156 | Ga0466719_480446 | 3300042606 | Bacteria | 45249 |
| 157 | Ga0466721_356399 | 3300042608 | Unclassified | 1232 |
| 158 | Ga0466698_273243 | 3300042610 | Unclassified | 1824 |
| 159 | JGI24698J34947_10011002 | 3300002449 | Unclassified | 4965 |
| 160 | JGI24699J35502_11047819 | 3300002509 | Unclassified | 1627 |
| 161 | CVPL005L_10000771 | 3300002938 | Bacteria | 66848 |
| 162 | Ga0466715_266596 | 3300042616 | Bacteria | 1771 |
| 163 | Ga0466715_622980 | 3300042616 | Bacteria | 273902 |
| 164 | Ga0466726_168919 | 3300042619 | Bacteria | 7610 |
| 165 | Ga0466703_259421 | 3300042636 | Unclassified | 12362 |
| 166 | Ga0466704_327672 | 3300042643 | Bacteria | 29858 |
| 167 | Ga0466704_558309 | 3300042643 | Unclassified | 3146 |
| 168 | Ga0466725_067311 | 3300042654 | Unclassified | 2404 |
| 169 | Ga0466725_347933 | 3300042654 | Unclassified | 1473 |
| 170 | Ga0466727_063579 | 3300042655 | Bacteria | 1902 |
| 171 | Ga0264413_139027 | 3300024493 | Bacteria | 7316 |
| 172 | Ga0466690_075583 | 3300042590 | Bacteria | 1529 |
| 173 | Ga0123355_10004073 | 3300009826 | Bacteria | 21190 |
| 174 | Ga0123353_10579659 | 3300010167 | Bacteria | 1610 |
| 175 | Ga0123353_11392613 | 3300010167 | Bacteria | 902 |
| 176 | Ga0466713_115678 | 3300042602 | Bacteria | 8658 |
| 177 | Ga0466714_165996 | 3300042603 | Bacteria | 9767 |
| 178 | Ga0466719_026353 | 3300042606 | Bacteria | 23907 |
| 179 | Ga0466722_004093 | 3300042609 | Bacteria | 1048 |
| 180 | IMNBL1DRAFT_c0000155 | 3300000062 | Bacteria | 61243 |
| 181 | Ga0466705_456326 | 3300042612 | Unclassified | 2162 |
| 182 | Ga0466711_320332 | 3300042615 | Bacteria | 16097 |
| 183 | Ga0466715_214294 | 3300042616 | Bacteria | 15234 |
| 184 | Ga0466734_098099 | 3300042623 | Bacteria | 4839 |
| 185 | Ga0466735_148542 | 3300042624 | Unclassified | 1792 |
| 186 | Ga0466703_095184 | 3300042636 | Bacteria | 1440 |
| 187 | Ga0466703_343356 | 3300042636 | Bacteria | 46819 |
| 188 | Ga0466704_011794 | 3300042643 | Unclassified | 1653 |
| 189 | Ga0466724_65846 | 3300042649 | Bacteria | 2482 |
| 190 | Ga0466708_076169 | 3300042652 | Bacteria | 2278 |
| 191 | Ga0466708_097335 | 3300042652 | Bacteria | 43487 |
| 192 | Ga0466708_274813 | 3300042652 | Bacteria | 19172 |
| 193 | Ga0466725_007764 | 3300042654 | Bacteria | 15372 |
| 194 | Ga0466733_029405 | 3300042659 | Bacteria | 6171 |
| 195 | Ga0233288_1025619 | 3300022232 | Unclassified | 1166 |
| 196 | Ga0255574_1000002 | 3300026545 | Bacteria | 247713 |
| 197 | Ga0466696_024651 | 3300042596 | Bacteria | 9366 |
| 198 | Ga0123357_10079768 | 3300009784 | Bacteria | 4308 |
| 199 | Ga0123356_10000008 | 3300010049 | Bacteria | 237851 |
| 200 | Ga0123353_11025818 | 3300010167 | Bacteria | 1105 |
| 201 | Ga0123353_11095863 | 3300010167 | Unclassified | 1058 |
| 202 | Ga0123353_11124399 | 3300010167 | Bacteria | 1040 |
| 203 | Ga0466700_319058 | 3300042600 | Bacteria | 6678 |
| 204 | Ga0466707_030371 | 3300042601 | Bacteria | 2956 |
| 205 | Ga0466717_094696 | 3300042604 | Bacteria | 1106 |
| 206 | AustNasuHG_c1000697 | 3300000089 | Bacteria | 11949 |
| 207 | AustNasuHG_c1013509 | 3300000089 | Unclassified | 2797 |
| 208 | FAAS_10313020 | 3300001880 | Unclassified | 504 |
| 209 | JGI24698J34947_10019777 | 3300002449 | Bacteria | 3628 |
| 210 | CVPL005L_10002197 | 3300002938 | Bacteria | 22446 |
| 211 | Ga0072941_1051993 | 3300005201 | Unclassified | 1480 |
| 212 | Ga0466711_474415 | 3300042615 | Bacteria | 1778 |
| 213 | Ga0466723_316361 | 3300042618 | Bacteria | 8270 |
| 214 | Ga0466726_032208 | 3300042619 | Bacteria | 5226 |
| 215 | Ga0466729_297157 | 3300042621 | Bacteria | 1084 |
| 216 | Ga0466731_013219 | 3300042622 | Bacteria | 4317 |
| 217 | Ga0466731_382882 | 3300042622 | Bacteria | 2471 |
| 218 | Ga0466703_390459 | 3300042636 | Bacteria | 32848 |
| 219 | Ga0466703_426546 | 3300042636 | Bacteria | 181657 |
| 220 | Ga0466704_560878 | 3300042643 | Bacteria | 95513 |
| 221 | Ga0466708_046732 | 3300042652 | Bacteria | 21026 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00164 | Ribosom_S12_S23 | Ribosomal protein S12/S23 | 33 | 143 | 0.97 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.