Protein Family IF06882

Metagenome Isolate
249 Members
208 Samples
93 Scaffolds
91.22 Avg Length

🧬 Representative Sequence

ID
3300042609|Ga0466722_201323|Ga0466722_201323_12636_12950
Length
104 aa
Sequence
VYHLNIFTHFREEYMNKAELIAAMAERAELSKKDAEKALTAFIDTVTDTLKEGEKVSLVGFGTFEARERAARVGINPRTKEKMNILATKTPSFKAGKAFKEVLK

📊 Sample Types

Isolate 62.6%
Metagenome 37.4%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 42.1%
Termitidae 8.2%
Drosophilidae 6.7%
Formicidae 6.2%
Kalotermitidae 4.6%
Anthocoridae 4.6%
Halictidae 4.1%
Elmidae 2.6%
Curculionidae 2.6%
Tenebrionidae 2.1%
Apidae 2.1%
Palinuridae 1.5%
Rhinotermitidae 1.5%
Talitridae 1.5%
Blattidae 1.0%
Majidae 1.0%
Lysianassidae 0.5%
Hodotermitidae 0.5%
Thripidae 0.5%
Artemiidae 0.5%
Calliphoridae 0.5%
Passalidae 0.5%
Pentatomidae 0.5%
Gryllidae 0.5%
Culicidae 0.5%
Scarabaeidae 0.5%
Nephropidae 0.5%
Penaeidae 0.5%
Pteromalidae 0.5%
Crambidae 0.5%
Termopsidae 0.5%

🌳 Taxonomy

Archaea 0
Bacteria 225
Eukaryota 0
Viruses 0
Unclassified 24

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2844251356 Photobacterium leiognathi mandapamensis ajapo.3.1 Isolate Unclassified
2 2858407585 Photobacterium swingsii DSM 24669 Isolate Unclassified
3 2864764899 Aeromonas fluvialis S00019 Isolate Elmidae
4 2864768727 Aeromonas veronii S00020 Isolate Elmidae
5 2880115952 Vibrio parahaemolyticus PB1937 Isolate Unclassified
6 2900349738 Photobacterium lucens CAIM 1938 Isolate Unclassified
7 2912636047 Vibrio crassostreae 9CS106 Isolate Unclassified
8 2940218408 Enterococcus sp. PF1-24 Isolate Blattidae
9 2065487013 Fungus-growing termite worker microbial communities from South Africa - Oerleman's Farm Metagenome
10 2501651205 Colwellia sp. MT41 Isolate Lysianassidae
11 2609459958 Vibrio nigripulchritudo Wn13 Isolate Unclassified
12 2630968716 Vibrio nigripulchritudo AM115 Isolate Unclassified
13 2636415542 Vibrio nigripulchritudo SFn135 Isolate Unclassified
14 2654587515 Vibrio owensii CAIM 1854 Isolate Palinuridae
15 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
16 3300056814 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) Metagenome Tenebrionidae
17 8048928574 Photobacterium swingsii CECT 7576 Isolate Unclassified
18 8066794103 Apilactobacillus timberlakei HV_25 Isolate Halictidae
19 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
20 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
21 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
22 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
23 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
24 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
25 3300002931 Ant worker gut metagenome for colony PL010 Metagenome Formicidae
26 3300007080 Ant gut microbial communities from Cephalotes clypeatus, Brazil Metagenome Formicidae
27 3300007153 Drosophila gut microbial communities from New York, USA - Drosophila putrida male 3 gut Metagenome Drosophilidae
28 3300007190 Ant gut microbial communities from Cephalotes umbraculatus, Peru Metagenome Formicidae
29 3300007192 Ant gut microbial communities from Cephalotes persimplex, Brazil Metagenome Formicidae
30 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
31 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
32 2850895757 Vibrio campbellii 170502 Isolate Unclassified
33 2860776474 Vibrio parahaemolyticus R14 Isolate Unclassified
34 2870361953 Entomomonas moraniae QZS01 Isolate Apidae
35 2871760914 Pantoea ananatis PANS 01-2 Isolate Thripidae
36 2872471378 Vibrio owensii V180403 Isolate Unclassified
37 2902916284 Pseudoalteromonas rubra S1946 Isolate Unclassified
38 2936628749 Apilactobacillus quenuiae HV_6 Isolate Halictidae
39 2571042430 Vibrio harveyi NBRC 15634 Isolate Talitridae
40 2603880173 Pseudomonas SP. Isolate Unclassified
41 2627854002 Vibrio nigripulchritudo ENn2 Isolate Unclassified
42 2687453755 Pseudomonadales bacterium Cag27 Isolate Unclassified
43 2711768158 Vibrio coralliilyticus S2043 Isolate Unclassified
44 2820096063 Unclassified Proteobacteria Lab288P3bin136 Isolate Unclassified
45 2820097968 Unclassified Proteobacteria Lab288P3bin104 Isolate Unclassified
46 2820353569 Unclassified Firmicutes Nt197P3bin28 Isolate Unclassified
47 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
48 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
49 651324086 Plautia crossota stali symbiont Isolate Unclassified
50 8001059720 Tenebrionicola larvae YMB-R22 Isolate Tenebrionidae
51 8022087107 Vibrio sp. OULL4 Isolate Unclassified
52 8022439116 Vibrio sp. ArtGut-C1 Isolate Artemiidae
53 8062647588 Nissabacter archeti JGM97 Isolate Drosophilidae
54 8066795793 Apilactobacillus timberlakei HV_10 Isolate Halictidae
55 8066799369 Apilactobacillus timberlakei HV_02 Isolate Halictidae
56 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
57 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
58 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
59 3001459110 Tatumella sp. JGM118 Isolate Drosophilidae
60 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
61 3300007766 Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 4 gut Metagenome Drosophilidae
62 2837516909 Rahnella bruchi DSM 27398 Isolate Unclassified
63 2885043073 Erwinia sp. OLSSP12 Isolate Anthocoridae
64 2896187957 Providencia stuartii Crippen Isolate Calliphoridae
65 2902438364 Photobacterium damselae Hep-2a-11 Isolate Unclassified
66 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
67 2648501820 Vibrio nigripulchritudo BLFn1 Isolate Unclassified
68 2667527830 Vibrio parahaemolyticus ISF-29-3 Isolate Unclassified
69 2700989396 Vibrio parahaemolyticus ISF-77-01 Isolate Unclassified
70 2785510762 Vibrio parahaemolyticus VP14 Isolate Unclassified
71 2820141685 Unclassified Proteobacteria Emb289P3bin118 Isolate Unclassified
72 2820344559 Unclassified Firmicutes Nt197P3bin63 Isolate Unclassified
73 8004571736 Serratia sp. OLDL1 Isolate Anthocoridae
74 8008122225 Vibrio harveyi CAIM 1792 Isolate Unclassified
75 8042061949 Vibrio harveyi Hep-2a-10 Isolate Unclassified
76 3300007140 Ant gut microbial communities from Cephalotes pallens, Brazil Metagenome Formicidae
77 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
78 2846386538 Rahnella sp. AN3-3W3 Isolate Pentatomidae
79 2868883784 Photobacterium leiognathi mandapamensis AJ-1a Isolate Unclassified
80 2940261461 Enterococcus sp. PFB1-1 Isolate Blattidae
81 2571042554 Vibrio owensii CAIM 1854 Isolate Palinuridae
82 2597489902 Providencia rettgeri Dmel1 Isolate Drosophilidae
83 2671180705 Pseudoalteromonas piscicida S2040 Isolate Unclassified
84 2687453756 Pseudomonadales bacterium Cag32 Isolate Unclassified
85 8033368880 Vibrio panuliri CAIM 1902 Isolate Palinuridae
86 8065462725 Tatumella sp. JGM100 Isolate Drosophilidae
87 8065466226 Tatumella sp. JGM130 Isolate Drosophilidae
88 8065469765 Tatumella sp. JGM16 Isolate Drosophilidae
89 8103002986 Erwinia sp. S38 Isolate Curculionidae
90 8103008710 Erwinia sp. S43 Isolate Curculionidae
91 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
92 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
93 3000478755 Entomomonas asaccharolytica F2A Isolate Gryllidae
94 3007478678 Pseudomonas sp. S37 Isolate Curculionidae
95 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
96 3300007129 Ant gut microbial communities from Cephalotes atratus, Brazil Metagenome Formicidae
97 3300007150 Drosophila gut microbial communities from New York, USA - Drosophila falleni female 3 gut Metagenome Drosophilidae
98 3300012798 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E6 MG Metagenome
99 3300012803 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E11 MG Metagenome
100 2871771314 Pantoea sp. Ae16 Isolate Culicidae
101 2885046828 Erwinia sp. OLCASP19 Isolate Anthocoridae
102 2885054481 Erwinia sp. OLMDSP33 Isolate Anthocoridae
103 2902451016 Photobacterium leiognathi mandapamensis ajapo.4.1 Isolate Unclassified
104 2902896024 Pseudoalteromonas sp. S1612 Isolate Unclassified
105 2908136803 Vibrio owensii 1700302 Isolate Unclassified
106 2511231129 Vibrio sp. EJY3 Isolate Unclassified
107 2529292851 Providencia burhodogranariea DSM 19968 Isolate Drosophilidae
108 2565956518 Vibrio pacinii DSM 19139 Isolate Unclassified
109 2600255074 Vibrio proteolyticus NBRC 13287 Isolate Unclassified
110 2687453754 Pseudomonadales bacterium Cag26 Isolate Unclassified
111 2693429575 Vibrio parahaemolyticus ISF-54-12 Isolate Unclassified
112 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
113 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
114 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
115 640963010 Vibrio harveyi HY01 Isolate Unclassified
116 648276708 Pantoea sp. aB Isolate Unclassified
117 8001394582 Limnobaculum allomyrinae BWR-B9 Isolate Scarabaeidae
118 8002304686 Apilactobacillus kunkeei UASWS1867-NN5 Isolate Apidae
119 8022345672 Vibrio sp. 070316B Isolate Unclassified
120 8033364368 Vibrio panuliri LBS 2 Isolate Nephropidae
121 8074292191 Tatumella sp. JGM94 Isolate Drosophilidae
122 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
123 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
124 2997380424 Vibrio parahaemolyticus MVP1 Isolate Unclassified
125 3300007042 Ant gut microbial communities from Cephalotes pusillus, Brazil Metagenome Formicidae
126 2848339753 Ephemeroptericola cinctiostellae F02 Isolate Unclassified
127 2864791955 Aeromonas veronii S00030 Isolate Elmidae
128 2875320051 Vibrio parahaemolyticus 160807 Isolate Unclassified
129 2877638525 Vibrio campbellii 1114GL Isolate Penaeidae
130 2877647439 Vibrio parahaemolyticus R13 Isolate Unclassified
131 2885058212 Erwinia sp. OLTSP20 Isolate Anthocoridae
132 2896925746 Vibrio nigripulchritudo SFn27 Isolate Unclassified
133 2902469402 Photobacterium lucens CAIM 1937 Isolate Unclassified
134 2558860143 Apilactobacillus kunkeei EFB6 Isolate Apidae
135 2585428048 Colwellia sp. NBT2012 Isolate
136 2609459925 Vibrio nigripulchritudo SO65 Isolate Unclassified
137 2627853677 Vibrio nigripulchritudo FTn2 Isolate Unclassified
138 2684622551 Vibrio campbellii E1 Isolate Unclassified
139 2731957638 Vibrio harveyi NBRC 15634 Isolate Talitridae
140 2820103659 Unclassified Proteobacteria Emb289P4bin67 Isolate Unclassified
141 2820154698 Unclassified Proteobacteria Cu122P5bin26 Isolate Unclassified
142 8022096067 Vibrio sp. SALL6 Isolate Unclassified
143 8022116796 Vibrio sp. T3Y01 Isolate Unclassified
144 8051461712 Vibrio vulnificus Vv002 Isolate
145 8060845732 Vibrio vulnificus Vv006 Isolate
146 8066790652 Apilactobacillus timberlakei HV_28 Isolate Halictidae
147 8066792404 Apilactobacillus timberlakei HV_04 Isolate Halictidae
148 8074288691 Tatumella sp. JGM82 Isolate Drosophilidae
149 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
150 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
151 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
152 2989793055 Vibrio atypicus DSM 25292 Isolate Unclassified
153 3001462594 Tatumella sp. JGM91 Isolate Drosophilidae
154 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
155 3300007188 Ant gut microbial communities from Cephalotes rohweri, Arizona, USA Metagenome Formicidae
156 2843904799 Shewanella khirikhana TH2012 Isolate Unclassified
157 2850131454 Providencia rettgeri NVIT03 Isolate Pteromalidae
158 2864777284 Aeromonas hydrophila S00023 Isolate Elmidae
159 2864796242 Aeromonas hydrophilia S00040 Isolate Elmidae
160 2873884416 Photobacterium sanguinicancri Mj110 CAIM 1827 Isolate Majidae
161 2923762712 Apilactobacillus micheneri Hlig3 Isolate Halictidae
162 2551306507 Vibrio parahaemolyticus PCV08-7 Isolate Unclassified
163 2585427605 Colwellia sp. MT2012 Isolate
164 2619619082 Pantoea agglomerans SL1_M5 Isolate Unclassified
165 2636415586 Vibrio harveyi NBRC 15634 Isolate Talitridae
166 2667527887 Vibrio harveyi LMG 4044 Isolate Unclassified
167 2675903377 Apilactobacillus kunkeei AR114 Isolate Unclassified
168 2791355471 Vibrio bivalvicida 605 Isolate Unclassified
169 2791355473 Vibrio barjaei 3062 Isolate Unclassified
170 2820100407 Unclassified Proteobacteria Lab288P1bin48 Isolate Unclassified
171 2820136564 Unclassified Proteobacteria Emb289P3bin18 Isolate Unclassified
172 8116627632 Vibrio penaeicida NBRC 15640 Isolate Unclassified
173 8048923410 Photobacterium sanguinicancri CECT 7579 Isolate Unclassified
174 8051534459 Vibrio vulnificus Vv004 Isolate
175 8099192374 Erwinia typographi IC4 Isolate Curculionidae
176 8110023836 Enterobacterales bacterium BIT-L3 Isolate Tenebrionidae
177 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
178 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
179 3000861951 Budvicia diplopodorum D9 Isolate
180 3006225627 Vibrio sp. Hep-1b-8 Isolate Unclassified
181 3006242587 Vibrio sp. RE86 Isolate Unclassified
182 3300002938 Larval gut metagenome for colony PL005 Metagenome Formicidae
183 3300003973 Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle Metagenome Curculionidae
184 3300007095 Ant gut microbial communities from Cephalotes minutus, Brazil Metagenome Formicidae
185 3300012852 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG Metagenome
186 2855798354 Achromobacter insolitus AR476-2 Isolate Crambidae
187 2877522083 Apilactobacillus bombintestini BHWM-4 Isolate Apidae
188 2885050628 Erwinia sp. OLMTSP26 Isolate Anthocoridae
189 2885061987 Erwinia sp. OLFS4 Isolate Anthocoridae
190 2885065815 Erwinia sp. OAMSP11 Isolate Anthocoridae
191 2889908211 Bowmanella denitrificans JL63 Isolate Unclassified
192 2912570088 Vibrio parahaemolyticus CHN25 Isolate
193 2528768159 Alteromonadaceae bacterium Bs31 Isolate Unclassified
194 2531839005 Vibrio harveyi CAIM 1792 Isolate Unclassified
195 2551306520 Aliivibrio logei ATCC 35077 Isolate Majidae
196 2554235022 Vibrio parahaemolyticus v110 Isolate
197 2648501158 Vibrio hepatarius DSM 19134 Isolate Unclassified
198 2663763317 Vibrio parahaemolyticus ISF-94-1 Isolate Unclassified
199 2820052737 Unclassified Proteobacteria Th196P3bin127 Isolate Unclassified
200 2820064859 Unclassified Proteobacteria Nt197P3bin78 Isolate Unclassified
201 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
202 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae
203 8004582426 Serratia sp. OSPLW9 Isolate Anthocoridae
204 8051551332 Vibrio vulnificus Vv003 Isolate
205 8066797744 Apilactobacillus timberlakei HV_26 Isolate Halictidae
206 3300007067 Ant gut microbial communities from Cephalotes spinosus, Peru Metagenome Formicidae
207 3300007068 Ant gut microbial communities from Cephalotes simillimus, Peru Metagenome Formicidae
208 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0562378_0034 3300056814 Bacteria 488617
2 JGI24705J35276_12174437 3300002504 Unclassified 1317
3 Ga0103265_1002189 3300007068 Unclassified 4096
4 Ga0102735_1000004 3300007080 Bacteria 71686
5 Ga0104050_1000314 3300007153 Bacteria 5200
6 Ga0466729_007634 3300042621 Bacteria 3580
7 Ga0123356_10001118 3300010049 Bacteria 29695
8 Ga0123353_10000016 3300010167 Bacteria 196885
9 JGI24705J35276_12197549 3300002504 Unclassified 1556
10 Ga0103266_1000058 3300007067 Bacteria 46132
11 Ga0415639_161392 3300038395 Bacteria 4365
12 Ga0466690_316526 3300042590 Unclassified 3108
13 Ga0466701_090359 3300042598 Bacteria 1183
14 Ga0466735_012244 3300042624 Bacteria 3665
15 Ga0466735_102148 3300042624 Bacteria 1399
16 Ga0466702_425749 3300042635 Bacteria 2335
17 Ga0466704_422796 3300042643 Bacteria 63367
18 Ga0160454_100283 3300012798 Bacteria 43827
19 Ga0466705_266504 3300042612 Unclassified 5590
20 2227524716 2225789004 Bacteria 652
21 JGI24702J35022_10463652 3300002462 Unclassified 773
22 JGI24702J35022_10540750 3300002462 Bacteria 717
23 CVPL010W_10033673 3300002931 Unclassified 1857
24 Ga0103266_1001197 3300007067 Unclassified 4580
25 Ga0102735_1002799 3300007080 Bacteria 2552
26 Ga0103267_1000173 3300007190 Bacteria 66101
27 Ga0466694_050565 3300042594 Bacteria 23836
28 Ga0466699_307763 3300042597 Bacteria 107526
29 Ga0466712_046182 3300042614 Bacteria 9211
30 Ga0466707_318640 3300042601 Bacteria 4174
31 Ga0466704_376554 3300042643 Bacteria 16572
32 Ga0123357_10339065 3300009784 Bacteria 1456
33 Ga0123355_10322250 3300009826 Bacteria 2081
34 Ga0123356_11137771 3300010049 Bacteria 948
35 Ga0123353_10000545 3300010167 Bacteria 46462
36 Ga0160465_110040 3300012803 Unclassified 766
37 Ga0562377_0183 3300056842 Bacteria 165152
38 Ga0102739_1001062 3300007095 Unclassified 4724
39 Ga0104050_1030697 3300007153 Unclassified 2021
40 Ga0123357_10000641 3300009784 Bacteria 34765
41 Ga0160430_100029 3300012852 Bacteria 200966
42 Ga0466691_106311 3300042593 Unclassified 5794
43 Ga0466723_297939 3300042618 Bacteria 11572
44 Ga0466728_457296 3300042620 Bacteria 126268
45 Ga0466706_063043 3300042599 Bacteria 1495
46 Ga0466706_183754 3300042599 Bacteria 2566
47 Ga0466722_201323 3300042609 Bacteria 18762
48 Ga0123357_10725508 3300009784 Unclassified 702
49 Ga0123356_11763665 3300010049 Bacteria 769
50 Ga0123353_10723902 3300010167 Bacteria 1391
51 Ga0466705_112814 3300042612 Unclassified 1046
52 Ga0068305_11085601 3300005083 Bacteria 1221
53 Ga0103268_1000001 3300007192 Bacteria 136024
54 Ga0466728_459838 3300042620 Bacteria 2885
55 Ga0466707_284362 3300042601 Bacteria 185230
56 Ga0466735_036091 3300042624 Bacteria 1475
57 Ga0466724_24217 3300042649 Unclassified 21131
58 Ga0123356_13614188 3300010049 Bacteria 535
59 Ga0123353_10821721 3300010167 Bacteria 1279
60 Ga0160465_110033 3300012803 Bacteria 767
61 Ga0466705_200093 3300042612 Unclassified 38183
62 CVPL005L_10021075 3300002938 Unclassified 3227
63 Ga0063521_1000156 3300003973 Bacteria 51654
64 Ga0103268_1000056 3300007192 Bacteria 49388
65 Ga0466710_053729 3300042613 Bacteria 15441
66 Ga0466729_106262 3300042621 Bacteria 4005
67 Ga0466701_051774 3300042598 Bacteria 3268
68 FGTW_contig00063 2065487013 Bacteria 28686
69 CVPL005L_10030350 3300002938 Bacteria 1825
70 Ga0415639_162927 3300038395 Bacteria 2495
71 Ga0466692_205494 3300042591 Bacteria 113668
72 Ga0466706_019733 3300042599 Bacteria 2063
73 Ga0466704_275446 3300042643 Bacteria 25021
74 Ga0123357_10192818 3300009784 Bacteria 2342
75 Ga0466705_042592 3300042612 Unclassified 2623
76 CVPL010W_10031916 3300002931 Unclassified 3135
77 Ga0063521_1000020 3300003973 Bacteria 138309
78 Ga0103263_102552 3300007042 Unclassified 2237
79 Ga0102734_1038004 3300007129 Bacteria 1252
80 Ga0102740_1000585 3300007140 Unclassified 9952
81 Ga0104019_1001797 3300007150 Bacteria 7170
82 Ga0103264_1000258 3300007188 Bacteria 30154
83 Ga0105003_1004694 3300007766 Bacteria 3309
84 Ga0466696_451039 3300042596 Bacteria 2568
85 Ga0466710_016777 3300042613 Bacteria 1524
86 Ga0466716_507267 3300042605 Unclassified 1177
87 Ga0466720_236615 3300042607 Unclassified 3367
88 Ga0466703_160963 3300042636 Bacteria 4525
89 Ga0466704_435605 3300042643 Unclassified 1709
90 Ga0466725_052767 3300042654 Bacteria 46776
91 Ga0466725_070062 3300042654 Bacteria 11381
92 Ga0123357_10022413 3300009784 Bacteria 8463
93 Ga0123356_10410776 3300010049 Bacteria 1493

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00216 Bac_DNA_binding Bacterial DNA-binding protein 15 103 0.99
PF18291 HU-HIG HU domain fused to wHTH, Ig, or Glycine-rich motif 11 103 0.82

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.