Protein Family IF06858
Metagenome
Isolate
151
Members
51
Samples
143
Scaffolds
211.63
Avg Length
Representative Sequence
- ID
- 3300042609|Ga0466722_176969|Ga0466722_176969_811_1473
- Length
- 220 aa
- Sequence
- MIISRVMTKNPVFVHPDMPVNDARALMDKENIGKLPVLDRDNRLVGIVTRKDMIKAGPSPATTLDMYEISYLLAKLKIEKIMERNVVTAGENEVVEEAARIMADKDISCLPVMRNFPDGKGGLLVGIITGTDLFRVFVNAFGARHPGIRVTLNMTEKPGQLARFAGSIAERGGNIVAFVSSEGDDLAHRRGTLKIAGLSKKDVEEIALSLSGAELEDIRE
Sample Types
Isolate
5.3%
Metagenome
94.7%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
38.8%
Kalotermitidae
28.6%
Unclassified
18.4%
Rhinotermitidae
6.1%
Termopsidae
6.1%
Hodotermitidae
2.0%
Taxonomy
Archaea
0
Bacteria
147
Eukaryota
0
Viruses
0
Unclassified
4
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2819992462 | Unclassified Spirochaetes Nc150P4bin14 | Isolate | Unclassified |
| 2 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 3 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 4 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 5 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 6 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 7 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 8 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 9 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 10 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 11 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 12 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 13 | 2228664003 | P3 Gut Segment Termite Single Cell Genome_Treponema sp. T4b from Florida, USA | Metagenome | Termitidae |
| 14 | 2781125681 | Treponema sp. Lab288P1bin11 | Isolate | Unclassified |
| 15 | 2781125691 | Treponema sp. Th196P3bin73 | Isolate | Unclassified |
| 16 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 17 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 18 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 19 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 20 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 21 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 22 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 23 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 24 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 25 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 26 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 27 | 650716099 | Leadbettera azotonutricia ZAS-9 | Isolate | Unclassified |
| 28 | 2781125656 | Treponema sp. Emb289P1bin65 | Isolate | Unclassified |
| 29 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 30 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 31 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 32 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 33 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 34 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 35 | 2781125629 | Treponema sp. Nt197P3bin20 | Isolate | Unclassified |
| 36 | 2781125639 | Treponema sp. Co191P1bin44 | Isolate | Unclassified |
| 37 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 38 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 39 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 40 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 41 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 42 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 43 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 44 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 45 | 2820020240 | Unclassified Spirochaetes Nc150P3bin10 | Isolate | Unclassified |
| 46 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 47 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 48 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 49 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 50 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 51 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466690_026067 | 3300042590 | Bacteria | 36637 |
| 2 | Ga0466690_237598 | 3300042590 | Bacteria | 1303 |
| 3 | Ga0466696_113483 | 3300042596 | Bacteria | 4904 |
| 4 | Ga0466712_052975 | 3300042614 | Bacteria | 1447 |
| 5 | Ga0466711_201299 | 3300042615 | Bacteria | 38820 |
| 6 | Ga0466723_051964 | 3300042618 | Bacteria | 24854 |
| 7 | Ga0466728_108551 | 3300042620 | Bacteria | 1235 |
| 8 | Ga0466702_126645 | 3300042635 | Bacteria | 15740 |
| 9 | Ga0466704_231644 | 3300042643 | Bacteria | 7446 |
| 10 | Ga0466708_120223 | 3300042652 | Bacteria | 1180 |
| 11 | Ga0123357_10053021 | 3300009784 | Bacteria | 5474 |
| 12 | Ga0123353_10399271 | 3300010167 | Bacteria | 2047 |
| 13 | Ga0072941_1036555 | 3300005201 | Bacteria | 6171 |
| 14 | Ga0466707_276844 | 3300042601 | Bacteria | 5727 |
| 15 | Ga0466707_314339 | 3300042601 | Bacteria | 3391 |
| 16 | Ga0466716_186080 | 3300042605 | Bacteria | 29993 |
| 17 | Ga0466719_118876 | 3300042606 | Bacteria | 22691 |
| 18 | Ga0466705_120802 | 3300042612 | Bacteria | 4235 |
| 19 | Ga0456237_0002530 | 3300041968 | Bacteria | 2957 |
| 20 | Ga0466691_076897 | 3300042593 | Bacteria | 7314 |
| 21 | Ga0466696_316920 | 3300042596 | Bacteria | 18667 |
| 22 | Ga0466711_210519 | 3300042615 | Bacteria | 1303 |
| 23 | Ga0466711_285228 | 3300042615 | Bacteria | 10926 |
| 24 | Ga0466715_324067 | 3300042616 | Bacteria | 3525 |
| 25 | Ga0466726_019602 | 3300042619 | Unclassified | 1185 |
| 26 | Ga0466726_160408 | 3300042619 | Bacteria | 1344 |
| 27 | Ga0466726_374531 | 3300042619 | Bacteria | 1696 |
| 28 | Ga0466728_116104 | 3300042620 | Bacteria | 6483 |
| 29 | Ga0466708_139336 | 3300042652 | Bacteria | 48639 |
| 30 | Ga0466727_016127 | 3300042655 | Bacteria | 2190 |
| 31 | Ga0466727_265526 | 3300042655 | Bacteria | 1738 |
| 32 | Ga0466727_316993 | 3300042655 | Bacteria | 1727 |
| 33 | Ga0123357_10007438 | 3300009784 | Bacteria | 13532 |
| 34 | JGI24698J34947_10008136 | 3300002449 | Bacteria | 5754 |
| 35 | Ga0466700_130311 | 3300042600 | Bacteria | 3743 |
| 36 | Ga0466720_034194 | 3300042607 | Bacteria | 1965 |
| 37 | Ga0466722_169315 | 3300042609 | Bacteria | 22756 |
| 38 | Ga0466722_176969 | 3300042609 | Bacteria | 1680 |
| 39 | Ga0466705_101951 | 3300042612 | Bacteria | 11451 |
| 40 | Ga0466732_308726 | 3300042656 | Bacteria | 2112 |
| 41 | Ga0466691_031377 | 3300042593 | Bacteria | 4001 |
| 42 | Ga0466691_223209 | 3300042593 | Bacteria | 41344 |
| 43 | Ga0466705_438118 | 3300042612 | Bacteria | 2179 |
| 44 | Ga0466718_037160 | 3300042617 | Bacteria | 7663 |
| 45 | Ga0466718_169863 | 3300042617 | Bacteria | 1824 |
| 46 | Ga0466723_132696 | 3300042618 | Bacteria | 2372 |
| 47 | Ga0466726_178798 | 3300042619 | Bacteria | 5405 |
| 48 | Ga0466704_180564 | 3300042643 | Bacteria | 35870 |
| 49 | Ga0466709_381739 | 3300042648 | Bacteria | 14083 |
| 50 | Ga0466727_329978 | 3300042655 | Bacteria | 3109 |
| 51 | Ga0123356_10096979 | 3300010049 | Bacteria | 2820 |
| 52 | Ga0123356_10424371 | 3300010049 | Bacteria | 1473 |
| 53 | Ga0123353_10749266 | 3300010167 | Bacteria | 1360 |
| 54 | Ga0466707_298814 | 3300042601 | Bacteria | 1068 |
| 55 | Ga0466720_124179 | 3300042607 | Bacteria | 9527 |
| 56 | Ga0466722_117313 | 3300042609 | Bacteria | 2184 |
| 57 | Ga0466705_066443 | 3300042612 | Bacteria | 6499 |
| 58 | Ga0264413_131152 | 3300024493 | Bacteria | 1977 |
| 59 | Ga0466690_088423 | 3300042590 | Bacteria | 3291 |
| 60 | Ga0466693_324560 | 3300042592 | Bacteria | 7678 |
| 61 | Ga0466718_170814 | 3300042617 | Bacteria | 14934 |
| 62 | Ga0466723_347817 | 3300042618 | Bacteria | 3081 |
| 63 | Ga0466726_042335 | 3300042619 | Bacteria | 1208 |
| 64 | Ga0466726_266766 | 3300042619 | Bacteria | 4226 |
| 65 | Ga0466726_275995 | 3300042619 | Bacteria | 1425 |
| 66 | Ga0466728_211606 | 3300042620 | Bacteria | 42029 |
| 67 | Ga0466708_084180 | 3300042652 | Bacteria | 11830 |
| 68 | Ga0466727_166384 | 3300042655 | Bacteria | 2908 |
| 69 | Ga0466706_093190 | 3300042599 | Bacteria | 1859 |
| 70 | Ga0466719_069362 | 3300042606 | Bacteria | 2312 |
| 71 | Ga0466720_124631 | 3300042607 | Bacteria | 3069 |
| 72 | Ga0466722_189090 | 3300042609 | Bacteria | 6122 |
| 73 | Ga0466691_155306 | 3300042593 | Bacteria | 8318 |
| 74 | Ga0466696_156343 | 3300042596 | Bacteria | 10330 |
| 75 | Ga0466699_255692 | 3300042597 | Bacteria | 1132 |
| 76 | Ga0466726_173638 | 3300042619 | Bacteria | 7460 |
| 77 | Ga0466726_296747 | 3300042619 | Bacteria | 1130 |
| 78 | Ga0466735_204245 | 3300042624 | Bacteria | 1247 |
| 79 | Ga0466703_030145 | 3300042636 | Bacteria | 2764 |
| 80 | Ga0466703_049555 | 3300042636 | Bacteria | 1315 |
| 81 | Ga0466709_013150 | 3300042648 | Bacteria | 5532 |
| 82 | Ga0466727_067922 | 3300042655 | Unclassified | 1156 |
| 83 | Ga0123353_10415473 | 3300010167 | Bacteria | 1996 |
| 84 | JGI24695J34938_10039337 | 3300002450 | Bacteria | 2137 |
| 85 | Ga0466719_521517 | 3300042606 | Bacteria | 1033 |
| 86 | Ga0466732_225054 | 3300042656 | Bacteria | 3789 |
| 87 | Ga0466691_014085 | 3300042593 | Bacteria | 15763 |
| 88 | Ga0466705_395594 | 3300042612 | Unclassified | 2732 |
| 89 | Ga0466705_425315 | 3300042612 | Bacteria | 8908 |
| 90 | Ga0466711_126379 | 3300042615 | Bacteria | 1540 |
| 91 | Ga0466711_129135 | 3300042615 | Bacteria | 31830 |
| 92 | Ga0466715_121759 | 3300042616 | Bacteria | 10742 |
| 93 | Ga0466715_327556 | 3300042616 | Bacteria | 6013 |
| 94 | Ga0466715_414587 | 3300042616 | Bacteria | 17703 |
| 95 | Ga0466723_134964 | 3300042618 | Bacteria | 2021 |
| 96 | Ga0466723_271080 | 3300042618 | Bacteria | 15562 |
| 97 | Ga0466728_015263 | 3300042620 | Bacteria | 32224 |
| 98 | Ga0466704_494829 | 3300042643 | Bacteria | 21929 |
| 99 | Ga0466708_090679 | 3300042652 | Bacteria | 7081 |
| 100 | Ga0123355_10107949 | 3300009826 | Bacteria | 4359 |
| 101 | Ga0123353_10044155 | 3300010167 | Bacteria | 7065 |
| 102 | Ga0123353_11113848 | 3300010167 | Bacteria | 1047 |
| 103 | 2230954194 | 2228664003 | Bacteria | 19769 |
| 104 | JGI24695J34938_10021282 | 3300002450 | Bacteria | 3174 |
| 105 | Ga0072941_1046234 | 3300005201 | Bacteria | 3154 |
| 106 | Ga0072941_1119855 | 3300005201 | Bacteria | 1931 |
| 107 | Ga0466706_132182 | 3300042599 | Unclassified | 1755 |
| 108 | Ga0466706_139885 | 3300042599 | Bacteria | 1747 |
| 109 | Ga0466705_008502 | 3300042612 | Bacteria | 1679 |
| 110 | Ga0466705_318869 | 3300042612 | Bacteria | 7251 |
| 111 | Ga0466732_071462 | 3300042656 | Bacteria | 2526 |
| 112 | Ga0466691_210248 | 3300042593 | Bacteria | 1711 |
| 113 | Ga0466711_001831 | 3300042615 | Bacteria | 2369 |
| 114 | Ga0466715_132448 | 3300042616 | Bacteria | 7300 |
| 115 | Ga0466723_100064 | 3300042618 | Bacteria | 25786 |
| 116 | Ga0466723_182605 | 3300042618 | Bacteria | 3704 |
| 117 | Ga0466726_017807 | 3300042619 | Bacteria | 2859 |
| 118 | Ga0466731_219877 | 3300042622 | Bacteria | 7389 |
| 119 | Ga0466703_404565 | 3300042636 | Bacteria | 22605 |
| 120 | Ga0466708_042827 | 3300042652 | Bacteria | 1254 |
| 121 | AustNasuHG_c1000181 | 3300000089 | Bacteria | 20597 |
| 122 | Ga0074263_110455 | 3300005485 | Bacteria | 5569 |
| 123 | Ga0466701_079540 | 3300042598 | Bacteria | 1131 |
| 124 | Ga0466732_107643 | 3300042656 | Bacteria | 3095 |
| 125 | Ga0466690_140089 | 3300042590 | Bacteria | 6911 |
| 126 | Ga0466692_156686 | 3300042591 | Bacteria | 117611 |
| 127 | Ga0466691_043084 | 3300042593 | Bacteria | 1970 |
| 128 | Ga0466696_157735 | 3300042596 | Bacteria | 11448 |
| 129 | Ga0466696_326201 | 3300042596 | Bacteria | 1252 |
| 130 | Ga0466711_459953 | 3300042615 | Bacteria | 1213 |
| 131 | Ga0466715_080210 | 3300042616 | Bacteria | 95686 |
| 132 | Ga0466715_632647 | 3300042616 | Bacteria | 3201 |
| 133 | Ga0466735_195196 | 3300042624 | Bacteria | 4026 |
| 134 | Ga0466703_181719 | 3300042636 | Bacteria | 13950 |
| 135 | Ga0466704_216757 | 3300042643 | Bacteria | 32252 |
| 136 | Ga0466704_341735 | 3300042643 | Bacteria | 1754 |
| 137 | Ga0123355_10334525 | 3300009826 | Bacteria | 2024 |
| 138 | Ga0123356_10492176 | 3300010049 | Bacteria | 1381 |
| 139 | Ga0072941_1014849 | 3300005201 | Bacteria | 4339 |
| 140 | Ga0466706_162395 | 3300042599 | Bacteria | 1353 |
| 141 | Ga0466716_476742 | 3300042605 | Bacteria | 5915 |
| 142 | Ga0466719_444209 | 3300042606 | Bacteria | 5004 |
| 143 | Ga0466722_060724 | 3300042609 | Bacteria | 12153 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.