Protein Family IF06791
Metagenome
Isolate
168
Members
52
Samples
164
Scaffolds
238.31
Avg Length
Representative Sequence
- ID
- 3300042609|Ga0466722_096322|Ga0466722_096322_1286_2116
- Length
- 276 aa
- Sequence
- LRFGSFSAISLVWQSQKKKLPNPCGNVSRNKGERMNRENGDALIVCQNAAFGYNGHNVVRGLSFAVLPGDYLCVVGENGSGKTTLVKGILGLLPPLEGSVSLAIRGKGTGYLSQESPSRKDFPAGVREVVLSGMAGRMGLRPFYSRREKEIAGENMRLLEIEDLQNRCFRELSGGQRRRVLIARSLCAGNTVLALDEPAAGLDPLVKAELYELLDTLNKETNIAVIMVTHDMEAAVKYANRILHVEKEQRFFGEIQEYLQSDTGKKFCTKGGRSND
Sample Types
Isolate
2.4%
Metagenome
97.6%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
42.0%
Kalotermitidae
28.0%
Unclassified
14.0%
Rhinotermitidae
6.0%
Termopsidae
4.0%
Passalidae
4.0%
Hodotermitidae
2.0%
Taxonomy
Archaea
0
Bacteria
156
Eukaryota
0
Viruses
0
Unclassified
12
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 2 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 3 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 4 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 5 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 6 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 7 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 8 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 9 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 10 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 11 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 12 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 13 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 14 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 15 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 16 | 2820353569 | Unclassified Firmicutes Nt197P3bin28 | Isolate | Unclassified |
| 17 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 18 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 19 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 20 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 21 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 22 | 2820275298 | Unclassified Firmicutes Th196P3bin17 | Isolate | Unclassified |
| 23 | 2820447167 | Unclassified Firmicutes Lab288P3bin192 | Isolate | Unclassified |
| 24 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 25 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 26 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 27 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 28 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 29 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 30 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 31 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 32 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 33 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 34 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 35 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 36 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 37 | 2820020240 | Unclassified Spirochaetes Nc150P3bin10 | Isolate | Unclassified |
| 38 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 39 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 40 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 41 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 42 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 43 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 44 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 45 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 46 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 47 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 48 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 49 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 50 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 51 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 52 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466733_057345 | 3300042659 | Bacteria | 10681 |
| 2 | Ga0466711_138824 | 3300042615 | Bacteria | 1307 |
| 3 | Ga0466715_305337 | 3300042616 | Bacteria | 16941 |
| 4 | Ga0466702_374051 | 3300042635 | Bacteria | 1140 |
| 5 | Ga0466702_452276 | 3300042635 | Bacteria | 5765 |
| 6 | Ga0466704_032398 | 3300042643 | Bacteria | 2435 |
| 7 | Ga0466704_420295 | 3300042643 | Bacteria | 11425 |
| 8 | Ga0466704_476763 | 3300042643 | Bacteria | 3292 |
| 9 | Ga0466706_272041 | 3300042599 | Bacteria | 2971 |
| 10 | Ga0466707_169729 | 3300042601 | Bacteria | 3786 |
| 11 | Ga0466707_358647 | 3300042601 | Bacteria | 1954 |
| 12 | Ga0466720_035220 | 3300042607 | Bacteria | 3655 |
| 13 | Ga0466720_069356 | 3300042607 | Bacteria | 6117 |
| 14 | Ga0466697_014089 | 3300042611 | Bacteria | 3435 |
| 15 | Ga0264413_122033 | 3300024493 | Bacteria | 1714 |
| 16 | Ga0415639_179721 | 3300038395 | Bacteria | 3309 |
| 17 | Ga0466690_118787 | 3300042590 | Bacteria | 29579 |
| 18 | Ga0466696_244005 | 3300042596 | Bacteria | 3130 |
| 19 | Ga0123356_10524520 | 3300010049 | Bacteria | 1343 |
| 20 | Ga0123356_10586345 | 3300010049 | Bacteria | 1279 |
| 21 | Ga0123353_10247585 | 3300010167 | Bacteria | 2764 |
| 22 | Ga0123353_10470671 | 3300010167 | Bacteria | 1842 |
| 23 | 2227591291 | 2225789004 | Bacteria | 12988 |
| 24 | AustNasuHG_c1003188 | 3300000089 | Bacteria | 5921 |
| 25 | JGI24698J34947_10028884 | 3300002449 | Bacteria | 2935 |
| 26 | Ga0072941_1020172 | 3300005201 | Unclassified | 8601 |
| 27 | Ga0466733_085244 | 3300042659 | Bacteria | 1685 |
| 28 | Ga0466712_281458 | 3300042614 | Unclassified | 1226 |
| 29 | Ga0466718_145144 | 3300042617 | Bacteria | 1623 |
| 30 | Ga0466723_020169 | 3300042618 | Bacteria | 9249 |
| 31 | Ga0466723_363123 | 3300042618 | Bacteria | 2593 |
| 32 | Ga0466704_293202 | 3300042643 | Bacteria | 1429 |
| 33 | Ga0466708_249081 | 3300042652 | Bacteria | 11493 |
| 34 | Ga0466727_188796 | 3300042655 | Bacteria | 2191 |
| 35 | Ga0466706_249691 | 3300042599 | Bacteria | 27960 |
| 36 | Ga0466707_179812 | 3300042601 | Bacteria | 1999 |
| 37 | Ga0466707_197673 | 3300042601 | Bacteria | 3203 |
| 38 | Ga0466707_253404 | 3300042601 | Bacteria | 7682 |
| 39 | Ga0466714_001119 | 3300042603 | Bacteria | 8517 |
| 40 | Ga0466714_050867 | 3300042603 | Bacteria | 16193 |
| 41 | Ga0466720_224443 | 3300042607 | Bacteria | 1902 |
| 42 | Ga0415639_008623 | 3300038395 | Bacteria | 7357 |
| 43 | Ga0466690_364560 | 3300042590 | Bacteria | 4940 |
| 44 | Ga0466691_146040 | 3300042593 | Bacteria | 2453 |
| 45 | Ga0123356_10255253 | 3300010049 | Bacteria | 1833 |
| 46 | Ga0123353_10087884 | 3300010167 | Bacteria | 5006 |
| 47 | Ga0123353_10254653 | 3300010167 | Bacteria | 2716 |
| 48 | Ga0123353_10971041 | 3300010167 | Bacteria | 1146 |
| 49 | Ga0466732_069899 | 3300042656 | Bacteria | 3106 |
| 50 | Ga0466732_273265 | 3300042656 | Bacteria | 18937 |
| 51 | Ga0466715_148788 | 3300042616 | Bacteria | 5984 |
| 52 | Ga0466715_350462 | 3300042616 | Bacteria | 102654 |
| 53 | Ga0466726_099059 | 3300042619 | Bacteria | 23072 |
| 54 | Ga0466726_266652 | 3300042619 | Bacteria | 6032 |
| 55 | Ga0466703_234815 | 3300042636 | Bacteria | 52704 |
| 56 | Ga0466704_067566 | 3300042643 | Bacteria | 2933 |
| 57 | Ga0466727_335534 | 3300042655 | Bacteria | 3773 |
| 58 | Ga0466713_150251 | 3300042602 | Bacteria | 5503 |
| 59 | Ga0466720_069212 | 3300042607 | Bacteria | 9347 |
| 60 | Ga0466722_084466 | 3300042609 | Bacteria | 18061 |
| 61 | Ga0466691_226914 | 3300042593 | Unclassified | 2112 |
| 62 | Ga0466694_314810 | 3300042594 | Bacteria | 2129 |
| 63 | Ga0123353_10704885 | 3300010167 | Bacteria | 1416 |
| 64 | Ga0123354_10332660 | 3300010882 | Bacteria | 1382 |
| 65 | Ga0074263_115604 | 3300005485 | Bacteria | 2054 |
| 66 | Ga0466732_264684 | 3300042656 | Unclassified | 1194 |
| 67 | Ga0466712_038134 | 3300042614 | Unclassified | 1763 |
| 68 | Ga0466723_017317 | 3300042618 | Bacteria | 8109 |
| 69 | Ga0466723_094468 | 3300042618 | Bacteria | 26470 |
| 70 | Ga0466723_229121 | 3300042618 | Bacteria | 13114 |
| 71 | Ga0466728_317256 | 3300042620 | Bacteria | 3094 |
| 72 | Ga0466708_234738 | 3300042652 | Bacteria | 19411 |
| 73 | Ga0466700_246197 | 3300042600 | Bacteria | 1573 |
| 74 | Ga0466719_179696 | 3300042606 | Bacteria | 1879 |
| 75 | Ga0466720_019572 | 3300042607 | Bacteria | 7555 |
| 76 | Ga0466722_073618 | 3300042609 | Bacteria | 8648 |
| 77 | Ga0264413_117405 | 3300024493 | Bacteria | 10725 |
| 78 | Ga0415639_074638 | 3300038395 | Bacteria | 1857 |
| 79 | Ga0466692_165820 | 3300042591 | Bacteria | 1298 |
| 80 | AustNasuHG_c1039603 | 3300000089 | Bacteria | 1167 |
| 81 | JGI24695J34938_10005171 | 3300002450 | Bacteria | 8251 |
| 82 | Ga0072940_1045602 | 3300005200 | Bacteria | 17786 |
| 83 | Ga0072941_1015913 | 3300005201 | Bacteria | 9255 |
| 84 | Ga0466705_069702 | 3300042612 | Bacteria | 37099 |
| 85 | Ga0466705_084653 | 3300042612 | Bacteria | 3206 |
| 86 | Ga0466726_406401 | 3300042619 | Bacteria | 4740 |
| 87 | Ga0466729_124147 | 3300042621 | Bacteria | 3936 |
| 88 | Ga0466702_240019 | 3300042635 | Bacteria | 1224 |
| 89 | Ga0466703_142640 | 3300042636 | Bacteria | 7576 |
| 90 | Ga0466704_134250 | 3300042643 | Bacteria | 3871 |
| 91 | Ga0466709_115669 | 3300042648 | Bacteria | 217304 |
| 92 | Ga0466722_140035 | 3300042609 | Bacteria | 3689 |
| 93 | Ga0466692_055697 | 3300042591 | Bacteria | 29527 |
| 94 | Ga0123355_10000574 | 3300009826 | Bacteria | 49477 |
| 95 | Ga0123356_10011691 | 3300010049 | Bacteria | 8551 |
| 96 | Ga0123356_10113163 | 3300010049 | Bacteria | 2625 |
| 97 | Ga0123353_10515741 | 3300010167 | Bacteria | 1736 |
| 98 | Ga0466705_361357 | 3300042612 | Bacteria | 5131 |
| 99 | Ga0466732_133291 | 3300042656 | Bacteria | 11346 |
| 100 | Ga0466732_405976 | 3300042656 | Bacteria | 1196 |
| 101 | Ga0466733_218509 | 3300042659 | Bacteria | 3121 |
| 102 | Ga0466712_191243 | 3300042614 | Bacteria | 1689 |
| 103 | Ga0466712_262943 | 3300042614 | Bacteria | 12636 |
| 104 | Ga0466718_021391 | 3300042617 | Bacteria | 5183 |
| 105 | Ga0466702_010676 | 3300042635 | Bacteria | 1403 |
| 106 | Ga0466704_164054 | 3300042643 | Bacteria | 11506 |
| 107 | Ga0466708_408392 | 3300042652 | Bacteria | 2150 |
| 108 | Ga0466716_421466 | 3300042605 | Bacteria | 2047 |
| 109 | Ga0466720_059350 | 3300042607 | Bacteria | 27311 |
| 110 | Ga0466720_062545 | 3300042607 | Bacteria | 17805 |
| 111 | Ga0466722_096322 | 3300042609 | Bacteria | 4609 |
| 112 | Ga0415639_001400 | 3300038395 | Bacteria | 43729 |
| 113 | Ga0466692_194825 | 3300042591 | Bacteria | 10966 |
| 114 | Ga0123355_10001926 | 3300009826 | Bacteria | 29185 |
| 115 | Ga0123353_10141404 | 3300010167 | Bacteria | 3855 |
| 116 | IMNBL1DRAFT_c0000080 | 3300000062 | Bacteria | 86870 |
| 117 | IMNBL1DRAFT_c0005120 | 3300000062 | Unclassified | 7624 |
| 118 | AustNasuHG_c1000176 | 3300000089 | Bacteria | 20767 |
| 119 | JGI24698J34947_10007288 | 3300002449 | Bacteria | 6076 |
| 120 | Ga0466712_212758 | 3300042614 | Unclassified | 3125 |
| 121 | Ga0466715_175093 | 3300042616 | Unclassified | 6214 |
| 122 | Ga0466718_037534 | 3300042617 | Bacteria | 2026 |
| 123 | Ga0466718_046748 | 3300042617 | Bacteria | 3309 |
| 124 | Ga0466718_094080 | 3300042617 | Bacteria | 16654 |
| 125 | Ga0466726_437032 | 3300042619 | Bacteria | 10714 |
| 126 | Ga0466709_108162 | 3300042648 | Bacteria | 2865 |
| 127 | Ga0466706_010866 | 3300042599 | Bacteria | 6451 |
| 128 | Ga0466713_096278 | 3300042602 | Unclassified | 10660 |
| 129 | Ga0466716_340280 | 3300042605 | Bacteria | 11169 |
| 130 | Ga0466719_288333 | 3300042606 | Bacteria | 1064 |
| 131 | Ga0415639_246235 | 3300038395 | Bacteria | 1524 |
| 132 | Ga0123356_10210257 | 3300010049 | Bacteria | 1993 |
| 133 | Ga0123353_10240578 | 3300010167 | Bacteria | 2813 |
| 134 | Ga0123353_10282338 | 3300010167 | Bacteria | 2549 |
| 135 | Ga0123353_10387000 | 3300010167 | Bacteria | 2089 |
| 136 | Ga0123353_10900362 | 3300010167 | Bacteria | 1205 |
| 137 | Ga0074263_116550 | 3300005485 | Unclassified | 1918 |
| 138 | Ga0466705_154816 | 3300042612 | Bacteria | 2691 |
| 139 | Ga0466705_434025 | 3300042612 | Bacteria | 6853 |
| 140 | Ga0466705_465860 | 3300042612 | Bacteria | 1498 |
| 141 | Ga0466712_021212 | 3300042614 | Bacteria | 1530 |
| 142 | Ga0466712_157047 | 3300042614 | Unclassified | 1863 |
| 143 | Ga0466711_326065 | 3300042615 | Bacteria | 1229 |
| 144 | Ga0466726_341367 | 3300042619 | Bacteria | 3185 |
| 145 | Ga0466703_304616 | 3300042636 | Bacteria | 21418 |
| 146 | Ga0466704_091282 | 3300042643 | Bacteria | 1742 |
| 147 | Ga0466704_491637 | 3300042643 | Bacteria | 1941 |
| 148 | Ga0466709_075176 | 3300042648 | Bacteria | 20360 |
| 149 | Ga0466709_330267 | 3300042648 | Bacteria | 16877 |
| 150 | Ga0466708_014693 | 3300042652 | Bacteria | 14000 |
| 151 | Ga0466727_067329 | 3300042655 | Bacteria | 27574 |
| 152 | Ga0466720_019677 | 3300042607 | Bacteria | 6437 |
| 153 | Ga0466720_054353 | 3300042607 | Bacteria | 3142 |
| 154 | Ga0466720_087814 | 3300042607 | Bacteria | 7130 |
| 155 | Ga0466722_232167 | 3300042609 | Bacteria | 1812 |
| 156 | Ga0466696_241225 | 3300042596 | Bacteria | 1321 |
| 157 | Ga0466699_413904 | 3300042597 | Bacteria | 18269 |
| 158 | Ga0123355_10527377 | 3300009826 | Bacteria | 1441 |
| 159 | Ga0123356_10368094 | 3300010049 | Bacteria | 1566 |
| 160 | Ga0123353_10424971 | 3300010167 | Bacteria | 1967 |
| 161 | 2227594084 | 2225789004 | Bacteria | 12733 |
| 162 | JGI24698J34947_10082084 | 3300002449 | Unclassified | 1508 |
| 163 | JGI24698J34947_10160798 | 3300002449 | Bacteria | 920 |
| 164 | Ga0068305_10001165 | 3300005083 | Bacteria | 21562 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.