Protein Family IF06764
Metagenome
Isolate
198
Members
69
Samples
187
Scaffolds
107.02
Avg Length
Representative Sequence
- ID
- 3300042609|Ga0466722_070034|Ga0466722_070034_2263_2640
- Length
- 125 aa
- Sequence
- MISGFPAIQRLTEQNMDRFSEYRIMWVMVFFDLPTETKKERKIASDFRKKIMNDGFTMFQFSIYLRHCASRENAEVHIKRVKSILPELGQIGILCITDKQFGQIELFQGKKEKPVTTPYQQLELF
Sample Types
Isolate
5.6%
Metagenome
94.4%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
44.9%
Kalotermitidae
18.8%
Unclassified
11.6%
Blattidae
7.2%
Rhinotermitidae
5.8%
Passalidae
4.3%
Termopsidae
4.3%
Hodotermitidae
1.4%
Daphniidae
1.4%
Taxonomy
Archaea
0
Bacteria
180
Eukaryota
0
Viruses
0
Unclassified
18
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820788205 | Unclassified Bacteroidetes Emb289P1bin57 | Isolate | Unclassified |
| 2 | 2940199050 | Parabacteroides sp. PM6-13 | Isolate | Blattidae |
| 3 | 2967483437 | Candidatus Ordinivivax streblomastigis St1 | Isolate | Unclassified |
| 4 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 5 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 6 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 7 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 8 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 9 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 10 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 11 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 12 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 13 | 3300000036 | Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) | Metagenome | Passalidae |
| 14 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 15 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 16 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 17 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 18 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 19 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 20 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 21 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 22 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 23 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 24 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 25 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 26 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 27 | 2590828803 | Pedobacter glucosidilyticus DD6b | Isolate | Daphniidae |
| 28 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 29 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 30 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 31 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 32 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 33 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 34 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 35 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 36 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 37 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 38 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 39 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 40 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 41 | 2820795054 | Unclassified Bacteroidetes Cu122P1bin21 | Isolate | Unclassified |
| 42 | 2922326829 | Bacteroides sp. 224 | Isolate | Blattidae |
| 43 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 44 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 45 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 46 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 47 | 2920168565 | Paludibacter sp. 221 | Isolate | Blattidae |
| 48 | 2940216256 | Dysgonomonadaceae bacterium PH5-43 | Isolate | Blattidae |
| 49 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 50 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 51 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 52 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 53 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 54 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 55 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 56 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 57 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 58 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 59 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 60 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 61 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 62 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 63 | 2820785563 | Unclassified Bacteroidetes Emb289P1bin74 | Isolate | Unclassified |
| 64 | 2820792843 | Unclassified Bacteroidetes Cu122P3bin1 | Isolate | Unclassified |
| 65 | 2940346213 | Parabacteroides sp. PFB2-12 | Isolate | Blattidae |
| 66 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 67 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 68 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 69 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466701_090709 | 3300042598 | Bacteria | 2014 |
| 2 | Ga0466706_000675 | 3300042599 | Bacteria | 73054 |
| 3 | Ga0466706_095063 | 3300042599 | Bacteria | 10492 |
| 4 | Ga0466716_080663 | 3300042605 | Bacteria | 7562 |
| 5 | Ga0466722_070034 | 3300042609 | Bacteria | 4932 |
| 6 | Ga0466698_265899 | 3300042610 | Bacteria | 2132 |
| 7 | Ga0123356_10087115 | 3300010049 | Bacteria | 2965 |
| 8 | Ga0123354_10391265 | 3300010882 | Bacteria | 1188 |
| 9 | Ga0466657_195169 | 3300042582 | Bacteria | 2868 |
| 10 | Ga0466693_401381 | 3300042592 | Bacteria | 5880 |
| 11 | Ga0466694_350611 | 3300042594 | Bacteria | 2385 |
| 12 | Ga0466729_240014 | 3300042621 | Unclassified | 4411 |
| 13 | Ga0466729_256886 | 3300042621 | Bacteria | 1885 |
| 14 | Ga0466735_004213 | 3300042624 | Bacteria | 2661 |
| 15 | Ga0466735_174427 | 3300042624 | Bacteria | 2137 |
| 16 | Ga0466703_057808 | 3300042636 | Bacteria | 1536 |
| 17 | Ga0466708_267723 | 3300042652 | Bacteria | 7880 |
| 18 | Ga0466708_269202 | 3300042652 | Bacteria | 3705 |
| 19 | Ga0466725_165355 | 3300042654 | Bacteria | 6456 |
| 20 | JGI24696J40584_12955650 | 3300002834 | Bacteria | 2888 |
| 21 | Ga0466710_261829 | 3300042613 | Bacteria | 2190 |
| 22 | Ga0466712_014448 | 3300042614 | Bacteria | 1096 |
| 23 | Ga0466729_081099 | 3300042621 | Bacteria | 1965 |
| 24 | Ga0466729_138917 | 3300042621 | Bacteria | 2410 |
| 25 | Ga0466700_028863 | 3300042600 | Unclassified | 2172 |
| 26 | Ga0466713_099126 | 3300042602 | Bacteria | 9339 |
| 27 | Ga0466717_115769 | 3300042604 | Bacteria | 1579 |
| 28 | Ga0466716_267799 | 3300042605 | Bacteria | 14884 |
| 29 | Ga0466720_204198 | 3300042607 | Bacteria | 1451 |
| 30 | Ga0466722_216757 | 3300042609 | Bacteria | 8578 |
| 31 | Ga0123357_10366591 | 3300009784 | Bacteria | 1356 |
| 32 | Ga0123354_10093738 | 3300010882 | Unclassified | 4125 |
| 33 | Ga0466690_165268 | 3300042590 | Bacteria | 2596 |
| 34 | Ga0466692_183752 | 3300042591 | Bacteria | 3950 |
| 35 | Ga0466693_441720 | 3300042592 | Bacteria | 1316 |
| 36 | Ga0466691_105420 | 3300042593 | Bacteria | 9648 |
| 37 | Ga0466697_089499 | 3300042611 | Bacteria | 34083 |
| 38 | Ga0466731_294324 | 3300042622 | Bacteria | 1158 |
| 39 | Ga0466735_160904 | 3300042624 | Bacteria | 5346 |
| 40 | Ga0466704_130934 | 3300042643 | Bacteria | 116573 |
| 41 | Ga0466709_393936 | 3300042648 | Bacteria | 1967 |
| 42 | IMNBL1DRAFT_c0004223 | 3300000062 | Unclassified | 8721 |
| 43 | JGI24695J34938_10020050 | 3300002450 | Bacteria | 3298 |
| 44 | JGI24696J40584_12926775 | 3300002834 | Bacteria | 1417 |
| 45 | Ga0068305_10000300 | 3300005083 | Bacteria | 21290 |
| 46 | Ga0466710_140900 | 3300042613 | Bacteria | 1418 |
| 47 | Ga0466711_155701 | 3300042615 | Bacteria | 12048 |
| 48 | Ga0466715_337359 | 3300042616 | Bacteria | 28968 |
| 49 | Ga0466726_254390 | 3300042619 | Bacteria | 3177 |
| 50 | Ga0466707_145030 | 3300042601 | Bacteria | 11635 |
| 51 | Ga0466713_011451 | 3300042602 | Bacteria | 25099 |
| 52 | Ga0466713_050425 | 3300042602 | Bacteria | 12094 |
| 53 | Ga0466714_129025 | 3300042603 | Bacteria | 1316 |
| 54 | Ga0123356_10195385 | 3300010049 | Bacteria | 2058 |
| 55 | Ga0123353_10412509 | 3300010167 | Unclassified | 2005 |
| 56 | Ga0415639_113145 | 3300038395 | Bacteria | 1019 |
| 57 | Ga0466693_245065 | 3300042592 | Bacteria | 1200 |
| 58 | Ga0466691_089511 | 3300042593 | Unclassified | 4572 |
| 59 | Ga0466696_024751 | 3300042596 | Bacteria | 10458 |
| 60 | Ga0466696_222660 | 3300042596 | Bacteria | 1724 |
| 61 | Ga0466696_359729 | 3300042596 | Bacteria | 8179 |
| 62 | Ga0466734_045790 | 3300042623 | Bacteria | 1096 |
| 63 | Ga0466734_168886 | 3300042623 | Bacteria | 1355 |
| 64 | Ga0466727_318905 | 3300042655 | Bacteria | 12067 |
| 65 | IMNBL1DRAFT_c0001463 | 3300000062 | Bacteria | 17649 |
| 66 | IMNBL1DRAFT_c0104821 | 3300000062 | Bacteria | 756 |
| 67 | JGI24705J35276_12086006 | 3300002504 | Bacteria | 984 |
| 68 | Ga0466711_230335 | 3300042615 | Bacteria | 11689 |
| 69 | Ga0466715_524863 | 3300042616 | Bacteria | 2273 |
| 70 | Ga0466706_094070 | 3300042599 | Bacteria | 1912 |
| 71 | Ga0466706_208913 | 3300042599 | Bacteria | 16667 |
| 72 | Ga0466706_289480 | 3300042599 | Bacteria | 4649 |
| 73 | Ga0466700_011915 | 3300042600 | Bacteria | 15523 |
| 74 | Ga0466707_106235 | 3300042601 | Bacteria | 9435 |
| 75 | Ga0466714_156086 | 3300042603 | Bacteria | 3185 |
| 76 | Ga0466714_164826 | 3300042603 | Bacteria | 12675 |
| 77 | Ga0123355_10002632 | 3300009826 | Bacteria | 25483 |
| 78 | Ga0123353_10121155 | 3300010167 | Bacteria | 4207 |
| 79 | Ga0466735_030061 | 3300042624 | Bacteria | 1311 |
| 80 | Ga0466735_160578 | 3300042624 | Bacteria | 1575 |
| 81 | Ga0466708_103882 | 3300042652 | Bacteria | 10201 |
| 82 | Ga0466727_003437 | 3300042655 | Bacteria | 2349 |
| 83 | Ga0068305_10365261 | 3300005083 | Bacteria | 941 |
| 84 | Ga0466710_010418 | 3300042613 | Bacteria | 9703 |
| 85 | Ga0466715_242598 | 3300042616 | Bacteria | 3567 |
| 86 | Ga0466715_467883 | 3300042616 | Bacteria | 5888 |
| 87 | Ga0466715_601675 | 3300042616 | Unclassified | 2726 |
| 88 | Ga0466715_610289 | 3300042616 | Bacteria | 12819 |
| 89 | Ga0466732_033635 | 3300042656 | Bacteria | 1624 |
| 90 | Ga0466701_017750 | 3300042598 | Bacteria | 34255 |
| 91 | Ga0466706_025794 | 3300042599 | Bacteria | 16084 |
| 92 | Ga0466706_207588 | 3300042599 | Bacteria | 7359 |
| 93 | Ga0466706_220676 | 3300042599 | Unclassified | 3070 |
| 94 | Ga0466707_242679 | 3300042601 | Unclassified | 1581 |
| 95 | Ga0466713_006404 | 3300042602 | Bacteria | 8911 |
| 96 | Ga0466717_207926 | 3300042604 | Bacteria | 1149 |
| 97 | Ga0123355_10301204 | 3300009826 | Bacteria | 2185 |
| 98 | Ga0456237_0026560 | 3300041968 | Bacteria | 786 |
| 99 | Ga0466690_335101 | 3300042590 | Bacteria | 3375 |
| 100 | Ga0466692_186461 | 3300042591 | Bacteria | 14378 |
| 101 | Ga0466731_381939 | 3300042622 | Bacteria | 3122 |
| 102 | Ga0466704_491635 | 3300042643 | Bacteria | 19994 |
| 103 | Ga0466709_127456 | 3300042648 | Bacteria | 8214 |
| 104 | 2227580487 | 2225789004 | Bacteria | 2516 |
| 105 | IMNBGM34_c011988 | 3300000036 | Bacteria | 1087 |
| 106 | JGI24702J35022_10001178 | 3300002462 | Bacteria | 16277 |
| 107 | JGI24702J35022_10355062 | 3300002462 | Bacteria | 877 |
| 108 | Ga0466715_559258 | 3300042616 | Bacteria | 2161 |
| 109 | Ga0466723_125517 | 3300042618 | Bacteria | 4110 |
| 110 | Ga0466723_276259 | 3300042618 | Bacteria | 2338 |
| 111 | Ga0466726_450773 | 3300042619 | Bacteria | 1236 |
| 112 | Ga0466729_028570 | 3300042621 | Bacteria | 1080 |
| 113 | Ga0466700_240702 | 3300042600 | Bacteria | 4216 |
| 114 | Ga0466707_047157 | 3300042601 | Bacteria | 1372 |
| 115 | Ga0466707_375905 | 3300042601 | Bacteria | 21271 |
| 116 | Ga0466722_093374 | 3300042609 | Bacteria | 5759 |
| 117 | Ga0123355_11170015 | 3300009826 | Unclassified | 789 |
| 118 | Ga0123353_11759180 | 3300010167 | Bacteria | 773 |
| 119 | Ga0466693_165785 | 3300042592 | Bacteria | 1025 |
| 120 | Ga0466696_146085 | 3300042596 | Bacteria | 2001 |
| 121 | Ga0466696_310195 | 3300042596 | Bacteria | 2010 |
| 122 | Ga0466696_351350 | 3300042596 | Bacteria | 1495 |
| 123 | Ga0466697_238578 | 3300042611 | Unclassified | 2415 |
| 124 | Ga0466731_326274 | 3300042622 | Unclassified | 2902 |
| 125 | Ga0466735_147559 | 3300042624 | Bacteria | 2623 |
| 126 | Ga0466709_349862 | 3300042648 | Unclassified | 1236 |
| 127 | Ga0466709_399987 | 3300042648 | Bacteria | 6990 |
| 128 | Ga0466727_024406 | 3300042655 | Bacteria | 1004 |
| 129 | 2227557952 | 2225789004 | Bacteria | 14709 |
| 130 | Ga0466710_450249 | 3300042613 | Bacteria | 2761 |
| 131 | Ga0466715_166925 | 3300042616 | Bacteria | 6280 |
| 132 | Ga0466726_343847 | 3300042619 | Bacteria | 2055 |
| 133 | Ga0466706_241939 | 3300042599 | Bacteria | 2063 |
| 134 | Ga0466706_283269 | 3300042599 | Bacteria | 44776 |
| 135 | Ga0466706_287806 | 3300042599 | Bacteria | 5196 |
| 136 | Ga0466707_184483 | 3300042601 | Bacteria | 10473 |
| 137 | Ga0466707_278215 | 3300042601 | Bacteria | 1613 |
| 138 | Ga0466714_091691 | 3300042603 | Bacteria | 12621 |
| 139 | Ga0466722_241135 | 3300042609 | Bacteria | 4440 |
| 140 | Ga0123356_10102076 | 3300010049 | Bacteria | 2753 |
| 141 | Ga0123353_10042320 | 3300010167 | Bacteria | 7203 |
| 142 | Ga0123353_10207382 | 3300010167 | Bacteria | 3077 |
| 143 | Ga0123354_10000543 | 3300010882 | Bacteria | 38707 |
| 144 | Ga0466657_188181 | 3300042582 | Bacteria | 14241 |
| 145 | Ga0466690_099393 | 3300042590 | Bacteria | 94849 |
| 146 | Ga0466690_195781 | 3300042590 | Bacteria | 11001 |
| 147 | Ga0466691_082040 | 3300042593 | Bacteria | 7075 |
| 148 | Ga0466691_101231 | 3300042593 | Bacteria | 36706 |
| 149 | Ga0466695_299578 | 3300042595 | Bacteria | 10314 |
| 150 | Ga0466705_146300 | 3300042612 | Unclassified | 1178 |
| 151 | Ga0466703_379850 | 3300042636 | Unclassified | 2345 |
| 152 | Ga0466703_414937 | 3300042636 | Unclassified | 1001 |
| 153 | Ga0466704_092462 | 3300042643 | Bacteria | 1404 |
| 154 | Ga0466725_089110 | 3300042654 | Bacteria | 1638 |
| 155 | Ga0466727_289926 | 3300042655 | Bacteria | 9017 |
| 156 | 2227264123 | 2225789004 | Bacteria | 6980 |
| 157 | IMNBGM34_c007449 | 3300000036 | Bacteria | 1409 |
| 158 | IMNBL1DRAFT_c0071069 | 3300000062 | Bacteria | 1004 |
| 159 | JGI24698J34947_10213235 | 3300002449 | Bacteria | 746 |
| 160 | JGI24702J35022_10020382 | 3300002462 | Bacteria | 3600 |
| 161 | Ga0072940_1115599 | 3300005200 | Bacteria | 511 |
| 162 | Ga0466733_180834 | 3300042659 | Bacteria | 1921 |
| 163 | Ga0466733_197914 | 3300042659 | Bacteria | 1283 |
| 164 | Ga0466706_145838 | 3300042599 | Bacteria | 1104 |
| 165 | Ga0466706_170737 | 3300042599 | Bacteria | 3335 |
| 166 | Ga0466707_083535 | 3300042601 | Bacteria | 6753 |
| 167 | Ga0466707_095236 | 3300042601 | Bacteria | 11193 |
| 168 | Ga0466717_049500 | 3300042604 | Bacteria | 1283 |
| 169 | Ga0466719_154040 | 3300042606 | Bacteria | 1820 |
| 170 | Ga0466719_346713 | 3300042606 | Bacteria | 4748 |
| 171 | Ga0466722_029941 | 3300042609 | Bacteria | 8480 |
| 172 | Ga0466722_103230 | 3300042609 | Bacteria | 2792 |
| 173 | Ga0123357_10694396 | 3300009784 | Bacteria | 732 |
| 174 | Ga0123354_10392875 | 3300010882 | Bacteria | 1183 |
| 175 | Ga0466690_235963 | 3300042590 | Bacteria | 1180 |
| 176 | Ga0466694_054943 | 3300042594 | Unclassified | 2531 |
| 177 | Ga0466696_089878 | 3300042596 | Bacteria | 1444 |
| 178 | Ga0466699_401042 | 3300042597 | Bacteria | 1318 |
| 179 | Ga0466705_016108 | 3300042612 | Bacteria | 2244 |
| 180 | Ga0466704_105408 | 3300042643 | Bacteria | 1096 |
| 181 | Ga0466704_376819 | 3300042643 | Bacteria | 49548 |
| 182 | Ga0466727_010596 | 3300042655 | Bacteria | 1339 |
| 183 | IMNBL1DRAFT_c0000459 | 3300000062 | Bacteria | 34114 |
| 184 | IMNBL1DRAFT_c0094818 | 3300000062 | Bacteria | 812 |
| 185 | IMNBL1DRAFT_c0145338 | 3300000062 | Unclassified | 611 |
| 186 | Ga0466715_040298 | 3300042616 | Bacteria | 8020 |
| 187 | Ga0466715_228802 | 3300042616 | Bacteria | 4487 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.