Protein Family IF06664
Metagenome
Isolate
217
Members
55
Samples
209
Scaffolds
220.66
Avg Length
Representative Sequence
- ID
- 3300042607|Ga0466720_129149|Ga0466720_129149_876_1658
- Length
- 260 aa
- Sequence
- MYTFPYTPYVFWNSLLLCDIILFTRVIIIMIEYVVPLNIDDRALAKASRVLEGGGLVALPTDTSWSIVCSLKSPNGVKKLRKLSGERDERHFTLLCSGISQFGELCSLDNSRFRLINRLSPGPYVFILKTLLGTEKALDIRRKEVGVRIPDHPIPLALIDTLQQPLYSITAKKTMHNDSEAFDYASDDFEEDAPGDNDSGELPPIPEDNLFEGGWELDGINGLDLILDGGEERDRVFSTILDLSGDDVKLLRQGAGAWPV
Sample Types
Isolate
3.7%
Metagenome
96.3%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
41.5%
Kalotermitidae
26.4%
Unclassified
15.1%
Rhinotermitidae
7.5%
Termopsidae
5.7%
Blaberidae
1.9%
Hodotermitidae
1.9%
Taxonomy
Archaea
2
Bacteria
204
Eukaryota
0
Viruses
0
Unclassified
11
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2772190975 | Treponema sp. RmG30 | Isolate | Blaberidae |
| 2 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 3 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 4 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 5 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 6 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 7 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 8 | 2781125685 | Treponema sp. Lab288P1bin13 | Isolate | Unclassified |
| 9 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 10 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 11 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 12 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 13 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 14 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 15 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 16 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 17 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 18 | 2781125643 | Treponema sp. Co191P3bin45 | Isolate | Unclassified |
| 19 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 20 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 21 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 22 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 23 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 24 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 25 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 26 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 27 | 2781125683 | Treponema sp. Lab288P1bin34 | Isolate | Unclassified |
| 28 | 2819992462 | Unclassified Spirochaetes Nc150P4bin14 | Isolate | Unclassified |
| 29 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 30 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 31 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 32 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 33 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 34 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 35 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 36 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 37 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 38 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 39 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 40 | 2820020240 | Unclassified Spirochaetes Nc150P3bin10 | Isolate | Unclassified |
| 41 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 42 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 43 | 2781125634 | Treponema sp. Co191P1bin45 | Isolate | Unclassified |
| 44 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 45 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 46 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 47 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 48 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 49 | 2781125631 | Treponema sp. Nt197P3bin89 | Isolate | Unclassified |
| 50 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 51 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 52 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 53 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 54 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 55 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_061834 | 3300042612 | Bacteria | 5357 |
| 2 | Ga0466732_005641 | 3300042656 | Bacteria | 25741 |
| 3 | Ga0466732_162487 | 3300042656 | Bacteria | 28930 |
| 4 | Ga0466718_119391 | 3300042617 | Bacteria | 1351 |
| 5 | Ga0466723_017538 | 3300042618 | Bacteria | 34729 |
| 6 | Ga0466726_109868 | 3300042619 | Bacteria | 1003 |
| 7 | Ga0123355_10187957 | 3300009826 | Bacteria | 3050 |
| 8 | Ga0123356_10010491 | 3300010049 | Bacteria | 9091 |
| 9 | Ga0123356_10034178 | 3300010049 | Bacteria | 4753 |
| 10 | Ga0466699_415282 | 3300042597 | Bacteria | 11126 |
| 11 | Ga0466707_235449 | 3300042601 | Bacteria | 5282 |
| 12 | Ga0466720_012462 | 3300042607 | Bacteria | 6396 |
| 13 | Ga0466720_018898 | 3300042607 | Bacteria | 38920 |
| 14 | AustNasuHG_c1005753 | 3300000089 | Bacteria | 4429 |
| 15 | AustNasuHG_c1035485 | 3300000089 | Bacteria | 1313 |
| 16 | JGI24702J35022_10061272 | 3300002462 | Unclassified | 2012 |
| 17 | Ga0072940_1027644 | 3300005200 | Bacteria | 1724 |
| 18 | Ga0466731_153093 | 3300042622 | Bacteria | 1386 |
| 19 | Ga0466735_061646 | 3300042624 | Unclassified | 2225 |
| 20 | Ga0466705_253546 | 3300042612 | Bacteria | 4543 |
| 21 | Ga0466718_007563 | 3300042617 | Bacteria | 1231 |
| 22 | Ga0466718_017962 | 3300042617 | Bacteria | 5779 |
| 23 | Ga0466723_200228 | 3300042618 | Bacteria | 22251 |
| 24 | Ga0466728_215055 | 3300042620 | Bacteria | 3460 |
| 25 | Ga0264413_106068 | 3300024493 | Bacteria | 5198 |
| 26 | Ga0466699_104106 | 3300042597 | Unclassified | 10659 |
| 27 | Ga0466699_115836 | 3300042597 | Bacteria | 3915 |
| 28 | Ga0466699_394117 | 3300042597 | Unclassified | 1505 |
| 29 | Ga0466706_233661 | 3300042599 | Bacteria | 38591 |
| 30 | Ga0466720_007150 | 3300042607 | Bacteria | 10712 |
| 31 | Ga0466720_035609 | 3300042607 | Bacteria | 50299 |
| 32 | Ga0466720_170704 | 3300042607 | Bacteria | 1225 |
| 33 | AustNasuHG_c1004656 | 3300000089 | Unclassified | 4922 |
| 34 | JGI24698J34947_10002029 | 3300002449 | Bacteria | 10795 |
| 35 | JGI24698J34947_10038100 | 3300002449 | Bacteria | 2495 |
| 36 | JGI24695J34938_10017531 | 3300002450 | Bacteria | 3604 |
| 37 | Ga0074263_108719 | 3300005485 | Bacteria | 1478 |
| 38 | Ga0466703_386823 | 3300042636 | Bacteria | 10527 |
| 39 | Ga0466704_434890 | 3300042643 | Bacteria | 41687 |
| 40 | Ga0466732_450869 | 3300042656 | Bacteria | 3962 |
| 41 | Ga0466712_207563 | 3300042614 | Bacteria | 94540 |
| 42 | Ga0466711_177598 | 3300042615 | Bacteria | 5849 |
| 43 | Ga0466715_564801 | 3300042616 | Bacteria | 1899 |
| 44 | Ga0466718_160027 | 3300042617 | Bacteria | 1983 |
| 45 | Ga0466726_047329 | 3300042619 | Bacteria | 9614 |
| 46 | Ga0123356_10825144 | 3300010049 | Bacteria | 1098 |
| 47 | Ga0456237_0005080 | 3300041968 | Unclassified | 2095 |
| 48 | Ga0466690_333914 | 3300042590 | Bacteria | 2626 |
| 49 | Ga0466692_042811 | 3300042591 | Bacteria | 2093 |
| 50 | Ga0466691_070680 | 3300042593 | Bacteria | 6983 |
| 51 | Ga0466694_335701 | 3300042594 | Bacteria | 3759 |
| 52 | Ga0466696_213209 | 3300042596 | Bacteria | 4655 |
| 53 | Ga0466699_278863 | 3300042597 | Bacteria | 2542 |
| 54 | Ga0466717_036939 | 3300042604 | Bacteria | 2042 |
| 55 | Ga0466716_091245 | 3300042605 | Bacteria | 7246 |
| 56 | Ga0466720_117535 | 3300042607 | Bacteria | 20172 |
| 57 | Ga0466720_204558 | 3300042607 | Bacteria | 4817 |
| 58 | JGI24695J34938_10004235 | 3300002450 | Bacteria | 9522 |
| 59 | Ga0466703_233189 | 3300042636 | Bacteria | 4637 |
| 60 | Ga0466704_016640 | 3300042643 | Bacteria | 4624 |
| 61 | Ga0466704_437242 | 3300042643 | Bacteria | 12782 |
| 62 | Ga0466705_012877 | 3300042612 | Bacteria | 21632 |
| 63 | Ga0466705_202035 | 3300042612 | Bacteria | 2417 |
| 64 | Ga0466732_111019 | 3300042656 | Bacteria | 24226 |
| 65 | Ga0466732_290720 | 3300042656 | Bacteria | 13045 |
| 66 | Ga0466705_461327 | 3300042612 | Bacteria | 5128 |
| 67 | Ga0466711_091584 | 3300042615 | Bacteria | 27785 |
| 68 | Ga0466715_085226 | 3300042616 | Bacteria | 2095 |
| 69 | Ga0466718_010630 | 3300042617 | Bacteria | 5877 |
| 70 | Ga0466718_072307 | 3300042617 | Bacteria | 15384 |
| 71 | Ga0466718_087950 | 3300042617 | Bacteria | 3411 |
| 72 | Ga0466726_235274 | 3300042619 | Archaea | 4142 |
| 73 | Ga0466728_122822 | 3300042620 | Bacteria | 4200 |
| 74 | Ga0264413_102080 | 3300024493 | Unclassified | 2509 |
| 75 | Ga0466692_144758 | 3300042591 | Bacteria | 2332 |
| 76 | Ga0466692_175385 | 3300042591 | Bacteria | 2122 |
| 77 | Ga0466691_002027 | 3300042593 | Bacteria | 5219 |
| 78 | Ga0466691_008365 | 3300042593 | Bacteria | 4739 |
| 79 | Ga0466694_157346 | 3300042594 | Bacteria | 1268 |
| 80 | Ga0466699_003058 | 3300042597 | Bacteria | 1558 |
| 81 | Ga0466706_094640 | 3300042599 | Bacteria | 1216 |
| 82 | Ga0466716_094974 | 3300042605 | Bacteria | 17045 |
| 83 | Ga0466716_217115 | 3300042605 | Bacteria | 1698 |
| 84 | Ga0466720_001047 | 3300042607 | Bacteria | 20870 |
| 85 | Ga0466720_049010 | 3300042607 | Unclassified | 4002 |
| 86 | Ga0466720_129149 | 3300042607 | Bacteria | 5439 |
| 87 | Ga0466720_173269 | 3300042607 | Bacteria | 1057 |
| 88 | Ga0466722_265857 | 3300042609 | Bacteria | 2825 |
| 89 | JGI24698J34947_10005370 | 3300002449 | Bacteria | 7028 |
| 90 | JGI24698J34947_10009582 | 3300002449 | Bacteria | 5311 |
| 91 | JGI24698J34947_10010833 | 3300002449 | Bacteria | 5004 |
| 92 | Ga0072941_1021003 | 3300005201 | Bacteria | 6898 |
| 93 | Ga0072941_1085598 | 3300005201 | Bacteria | 6398 |
| 94 | Ga0074263_103435 | 3300005485 | Bacteria | 1474 |
| 95 | Ga0074263_105821 | 3300005485 | Bacteria | 1600 |
| 96 | Ga0466703_021308 | 3300042636 | Bacteria | 6611 |
| 97 | Ga0466703_386298 | 3300042636 | Bacteria | 13493 |
| 98 | Ga0466703_410875 | 3300042636 | Bacteria | 3963 |
| 99 | Ga0466704_085208 | 3300042643 | Bacteria | 8661 |
| 100 | Ga0466708_045984 | 3300042652 | Bacteria | 6966 |
| 101 | Ga0466708_307922 | 3300042652 | Bacteria | 14416 |
| 102 | Ga0466705_216324 | 3300042612 | Bacteria | 4027 |
| 103 | Ga0466712_013613 | 3300042614 | Bacteria | 5799 |
| 104 | Ga0466718_098305 | 3300042617 | Bacteria | 1643 |
| 105 | Ga0466728_374247 | 3300042620 | Bacteria | 3074 |
| 106 | Ga0123356_10807002 | 3300010049 | Bacteria | 1109 |
| 107 | Ga0264413_100247 | 3300024493 | Bacteria | 36643 |
| 108 | Ga0466690_019499 | 3300042590 | Bacteria | 5264 |
| 109 | Ga0466690_271874 | 3300042590 | Bacteria | 3582 |
| 110 | Ga0466699_159251 | 3300042597 | Bacteria | 2860 |
| 111 | Ga0466700_133220 | 3300042600 | Bacteria | 2646 |
| 112 | Ga0466707_213017 | 3300042601 | Bacteria | 2720 |
| 113 | Ga0466720_029091 | 3300042607 | Bacteria | 10128 |
| 114 | Ga0466722_008192 | 3300042609 | Bacteria | 9038 |
| 115 | Ga0466722_161109 | 3300042609 | Bacteria | 1259 |
| 116 | JGI24698J34947_10036746 | 3300002449 | Bacteria | 2549 |
| 117 | JGI24699J35502_11130420 | 3300002509 | Bacteria | 5100 |
| 118 | Ga0072940_1004109 | 3300005200 | Unclassified | 11881 |
| 119 | Ga0072941_1000579 | 3300005201 | Bacteria | 109731 |
| 120 | Ga0466731_150150 | 3300042622 | Bacteria | 73009 |
| 121 | Ga0466702_129078 | 3300042635 | Bacteria | 2608 |
| 122 | Ga0466702_213059 | 3300042635 | Bacteria | 1385 |
| 123 | Ga0466704_080457 | 3300042643 | Bacteria | 7873 |
| 124 | Ga0466704_379441 | 3300042643 | Bacteria | 22236 |
| 125 | Ga0466708_363402 | 3300042652 | Bacteria | 22632 |
| 126 | Ga0466712_082988 | 3300042614 | Bacteria | 2183 |
| 127 | Ga0466723_262644 | 3300042618 | Bacteria | 11089 |
| 128 | Ga0123353_11497960 | 3300010167 | Bacteria | 860 |
| 129 | Ga0264413_111745 | 3300024493 | Bacteria | 49890 |
| 130 | Ga0264413_115268 | 3300024493 | Bacteria | 1121 |
| 131 | Ga0466692_041962 | 3300042591 | Bacteria | 17048 |
| 132 | Ga0466692_085849 | 3300042591 | Bacteria | 1592 |
| 133 | Ga0466691_047241 | 3300042593 | Bacteria | 7287 |
| 134 | Ga0466694_028369 | 3300042594 | Bacteria | 1059 |
| 135 | Ga0466694_155826 | 3300042594 | Bacteria | 14964 |
| 136 | Ga0466699_010118 | 3300042597 | Bacteria | 3022 |
| 137 | Ga0466699_076271 | 3300042597 | Archaea | 3704 |
| 138 | Ga0466719_118797 | 3300042606 | Bacteria | 11038 |
| 139 | Ga0466719_276867 | 3300042606 | Bacteria | 13939 |
| 140 | Ga0466720_013698 | 3300042607 | Bacteria | 3119 |
| 141 | Ga0466720_123142 | 3300042607 | Bacteria | 2943 |
| 142 | Ga0466722_058526 | 3300042609 | Bacteria | 27862 |
| 143 | Ga0466698_407454 | 3300042610 | Bacteria | 1575 |
| 144 | Ga0466729_201026 | 3300042621 | Bacteria | 1247 |
| 145 | Ga0466702_092852 | 3300042635 | Bacteria | 13928 |
| 146 | Ga0466702_426199 | 3300042635 | Bacteria | 12559 |
| 147 | Ga0466703_247509 | 3300042636 | Bacteria | 18485 |
| 148 | Ga0466727_219132 | 3300042655 | Bacteria | 7035 |
| 149 | Ga0466705_289833 | 3300042612 | Bacteria | 4240 |
| 150 | Ga0466705_423705 | 3300042612 | Bacteria | 8774 |
| 151 | Ga0466712_092811 | 3300042614 | Bacteria | 22383 |
| 152 | Ga0466715_564054 | 3300042616 | Bacteria | 2928 |
| 153 | Ga0466718_051728 | 3300042617 | Bacteria | 17202 |
| 154 | Ga0466718_077824 | 3300042617 | Bacteria | 37727 |
| 155 | Ga0466723_135272 | 3300042618 | Bacteria | 14640 |
| 156 | Ga0466726_472661 | 3300042619 | Bacteria | 2336 |
| 157 | Ga0123356_10002030 | 3300010049 | Bacteria | 21866 |
| 158 | Ga0123356_10009147 | 3300010049 | Bacteria | 9798 |
| 159 | Ga0456237_0024329 | 3300041968 | Unclassified | 827 |
| 160 | Ga0466693_152830 | 3300042592 | Bacteria | 52782 |
| 161 | Ga0466694_210720 | 3300042594 | Bacteria | 12727 |
| 162 | Ga0466694_253294 | 3300042594 | Bacteria | 1043 |
| 163 | Ga0466696_399755 | 3300042596 | Bacteria | 12463 |
| 164 | Ga0466699_008293 | 3300042597 | Bacteria | 3562 |
| 165 | Ga0466719_129188 | 3300042606 | Bacteria | 5011 |
| 166 | Ga0466719_236635 | 3300042606 | Bacteria | 3208 |
| 167 | Ga0466720_027918 | 3300042607 | Bacteria | 5647 |
| 168 | Ga0466720_069906 | 3300042607 | Bacteria | 9086 |
| 169 | Ga0466720_145465 | 3300042607 | Unclassified | 3041 |
| 170 | JGI24698J34947_10001269 | 3300002449 | Bacteria | 13216 |
| 171 | Ga0466731_095716 | 3300042622 | Bacteria | 1663 |
| 172 | Ga0466702_047507 | 3300042635 | Bacteria | 1106 |
| 173 | Ga0466703_023643 | 3300042636 | Bacteria | 4774 |
| 174 | Ga0466703_080816 | 3300042636 | Bacteria | 8501 |
| 175 | Ga0466709_108093 | 3300042648 | Bacteria | 16869 |
| 176 | Ga0466705_027963 | 3300042612 | Bacteria | 2806 |
| 177 | Ga0466711_487714 | 3300042615 | Bacteria | 1650 |
| 178 | Ga0466718_045873 | 3300042617 | Bacteria | 2439 |
| 179 | Ga0466718_102724 | 3300042617 | Bacteria | 13187 |
| 180 | Ga0466723_337329 | 3300042618 | Bacteria | 2590 |
| 181 | Ga0466726_048381 | 3300042619 | Bacteria | 4759 |
| 182 | Ga0466728_143358 | 3300042620 | Bacteria | 14463 |
| 183 | Ga0123356_10069467 | 3300010049 | Bacteria | 3303 |
| 184 | Ga0123356_10131132 | 3300010049 | Bacteria | 2456 |
| 185 | Ga0123356_11174690 | 3300010049 | Bacteria | 934 |
| 186 | Ga0466691_093803 | 3300042593 | Bacteria | 12330 |
| 187 | Ga0466691_175563 | 3300042593 | Bacteria | 5514 |
| 188 | Ga0466694_291034 | 3300042594 | Bacteria | 1925 |
| 189 | Ga0466699_017432 | 3300042597 | Bacteria | 5528 |
| 190 | Ga0466699_208579 | 3300042597 | Bacteria | 16371 |
| 191 | Ga0466706_258947 | 3300042599 | Bacteria | 1812 |
| 192 | Ga0466707_071103 | 3300042601 | Bacteria | 1647 |
| 193 | Ga0466716_441405 | 3300042605 | Bacteria | 7136 |
| 194 | Ga0466719_076909 | 3300042606 | Bacteria | 12032 |
| 195 | Ga0466719_330281 | 3300042606 | Bacteria | 2715 |
| 196 | Ga0466722_245480 | 3300042609 | Bacteria | 5125 |
| 197 | AustNasuHG_c1000108 | 3300000089 | Bacteria | 24878 |
| 198 | AustNasuHG_c1001360 | 3300000089 | Bacteria | 8750 |
| 199 | JGI24698J34947_10039540 | 3300002449 | Bacteria | 2441 |
| 200 | JGI24695J34938_10027587 | 3300002450 | Bacteria | 2682 |
| 201 | Ga0072940_1011733 | 3300005200 | Bacteria | 22116 |
| 202 | Ga0074263_103137 | 3300005485 | Bacteria | 2322 |
| 203 | Ga0466702_025267 | 3300042635 | Bacteria | 2134 |
| 204 | Ga0466702_200648 | 3300042635 | Bacteria | 8529 |
| 205 | Ga0466703_302811 | 3300042636 | Bacteria | 16476 |
| 206 | Ga0466703_398148 | 3300042636 | Bacteria | 4083 |
| 207 | Ga0466704_500097 | 3300042643 | Bacteria | 7084 |
| 208 | Ga0466709_050184 | 3300042648 | Bacteria | 11660 |
| 209 | Ga0466727_330643 | 3300042655 | Bacteria | 1041 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01300 | Sua5_yciO_yrdC | Telomere recombination | 50 | 191 | 0.92 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF01300 | GO:0003725 | double-stranded RNA binding | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.