Protein Family IF06618
Metagenome
Metatranscriptome
Isolate
399
Members
166
Samples
312
Scaffolds
85.82
Avg Length
Representative Sequence
- ID
- 3300042607|Ga0466720_033681|Ga0466720_033681_460_768
- Length
- 102 aa
- Sequence
- VQKRYLRKKVLIEVEIMTEERNRRKVRTGVVVSDKADKTITVSVQRQEVHPKYGKIIRLNKKYKAHDEKNESHIGDTVRIMETRPLSKTKCWRLVEIVEKAK
Sample Types
Isolate
21.8%
Metagenome
76.9%
MAG
0.0%
Metatranscriptome
1.2%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
27.0%
Termitidae
24.5%
Apidae
12.3%
Blattidae
11.7%
Kalotermitidae
8.0%
Rhinotermitidae
3.1%
Termopsidae
2.5%
Drosophilidae
2.5%
Elmidae
1.8%
Passalidae
1.8%
Tenebrionidae
1.2%
Daphniidae
0.6%
Formicidae
0.6%
Hodotermitidae
0.6%
Culicidae
0.6%
Armadillidiidae
0.6%
Harpacticidae
0.6%
Taxonomy
Archaea
0
Bacteria
355
Eukaryota
0
Viruses
0
Unclassified
44
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820788205 | Unclassified Bacteroidetes Emb289P1bin57 | Isolate | Unclassified |
| 2 | 2894649344 | Allomuricauda alvinocaridis SCR12 | Isolate | Unclassified |
| 3 | 2940199050 | Parabacteroides sp. PM6-13 | Isolate | Blattidae |
| 4 | 2940202316 | Parabacteroides sp. PF5-9 | Isolate | Blattidae |
| 5 | 2940371297 | Parabacteroides sp. PM5-20 | Isolate | Blattidae |
| 6 | 2958885890 | Lactobacillus sp. ESL0234 | Isolate | Apidae |
| 7 | 2961465228 | Lactobacillus sp. ESL0233 | Isolate | Apidae |
| 8 | 2684622911 | Lactobacillus kullabergensis Lb_186 | Isolate | Unclassified |
| 9 | 2684622914 | Lactobacillus helsinborgensis Lb_183 | Isolate | Unclassified |
| 10 | 2758568507 | Lactobacillus bombicola ESL0237 | Isolate | Unclassified |
| 11 | 2758568508 | Lactobacillus bombicola ESL0236 | Isolate | Unclassified |
| 12 | 2758568512 | Lactobacillus helsingborgensis ESL0262 | Isolate | Unclassified |
| 13 | 2811995047 | Flavobacterium succinicans DD5b | Isolate | Daphniidae |
| 14 | 2820507989 | Unclassified Firmicutes Lab288P1bin41 | Isolate | Unclassified |
| 15 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 16 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 17 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 18 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 19 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 20 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 21 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 22 | 3004719924 | Lactobacillus sp. W8174 | Isolate | Apidae |
| 23 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 24 | 3300005319 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea female 2 gut | Metagenome | Drosophilidae |
| 25 | 3300007149 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 4 gut | Metagenome | Drosophilidae |
| 26 | 2968368220 | Lactobacillus bombicola OCC3 | Isolate | Apidae |
| 27 | 2971062614 | Lactobacillus bombicola BI-4G | Isolate | Apidae |
| 28 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 29 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 30 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 31 | 2882334426 | Lactobacillus sp. 2-3 | Isolate | Unclassified |
| 32 | 2910926975 | Dysgonomonas sp. 25 | Isolate | Blattidae |
| 33 | 2940209341 | Parabacteroides sp. PFB2-10 | Isolate | Blattidae |
| 34 | 2940336608 | Dysgonomonas sp. PH5-37 | Isolate | Blattidae |
| 35 | 2758568509 | Lactobacillus bombicola ESL0234 | Isolate | Unclassified |
| 36 | 2758568510 | Lactobacillus bombicola ESL0233 | Isolate | Unclassified |
| 37 | 2799112231 | Apibacter sp. ESL0432 | Isolate | Unclassified |
| 38 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 39 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 40 | 3300007505 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut | Metagenome | Drosophilidae |
| 41 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 42 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 43 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 44 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 45 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 46 | 2820762746 | Unclassified Bacteroidetes Mp193P4bin3 | Isolate | Unclassified |
| 47 | 2864836148 | Arcicella rosea S00070 | Isolate | Elmidae |
| 48 | 2864878056 | Flavobacterium notoginsengisoli S00128 | Isolate | Elmidae |
| 49 | 2864886855 | Flavobacterium nitrogenifigens S00142 | Isolate | Elmidae |
| 50 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 51 | 2758568504 | Lactobacillus bombicola ESL0245 | Isolate | Unclassified |
| 52 | 2758568515 | Lactobacillus melliventris ESL0259 | Isolate | Unclassified |
| 53 | 2778260940 | Unclassified Fibrobacteres Mp193P3bin36 | Isolate | Unclassified |
| 54 | 2820277137 | Unclassified Firmicutes Th196P3bin150 | Isolate | Unclassified |
| 55 | 3300007143 | Drosophila gut microbial communities from New York, USA - Drosophila putrida female 3 gut | Metagenome | Drosophilidae |
| 56 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 57 | 2695420314 | Dysgonomonas sp. BGC7 | Isolate | Unclassified |
| 58 | 2758568505 | Lactobacillus bombicola ESL0225 | Isolate | Unclassified |
| 59 | 2758568514 | Lactobacillus kullabergensis ESL0261 | Isolate | Unclassified |
| 60 | 2785510743 | Apibacter sp. ESL0404 | Isolate | Apidae |
| 61 | 2820741847 | Unclassified Bacteroidetes Th196P3bin71 | Isolate | Unclassified |
| 62 | 2645727721 | Lactobacillus helsingborgensis Bma5 | Isolate | Unclassified |
| 63 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 64 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 65 | 8017536074 | Lactobacillus sp. ESL0261 | Isolate | Apidae |
| 66 | 8065497608 | Tellurirhabdus bombi IE-0392 | Isolate | Apidae |
| 67 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 68 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 69 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 70 | 2979949929 | Lactobacillus sp. ESL0263 | Isolate | Apidae |
| 71 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 72 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 73 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 74 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 75 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 76 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 77 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 78 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 79 | 2820770630 | Unclassified Bacteroidetes Lab288P3bin130 | Isolate | Unclassified |
| 80 | 2882250448 | Bizionia sp. APA-3 | Isolate | |
| 81 | 2910949487 | Dysgonomonas sp. 520 | Isolate | Blattidae |
| 82 | 2910959314 | Dysgonomonas sp. 511 | Isolate | Blattidae |
| 83 | 2923982719 | Parabacteroides sp. 52 | Isolate | Blattidae |
| 84 | 2820873081 | Unclassified Actinobacteria Lab288P1bin96 | Isolate | Unclassified |
| 85 | 2851410423 | Lactobacillus helsingborgensis ESL0183 | Isolate | Apidae |
| 86 | 2758568501 | Lactobacillus bombicola ESL0228 | Isolate | Unclassified |
| 87 | 2758568502 | Lactobacillus bombicola ESL0247 | Isolate | Unclassified |
| 88 | 2758568503 | Lactobacillus bombicola ESL0246 | Isolate | Unclassified |
| 89 | 2758568511 | Lactobacillus apis ESL0263 | Isolate | Unclassified |
| 90 | 2820495292 | Unclassified Firmicutes Lab288P1bin59 | Isolate | Unclassified |
| 91 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 92 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 93 | 8100157865 | Dysgonomonas sp. GY617 | Isolate | Rhinotermitidae |
| 94 | 8004832522 | Lactobacillus sp. ESL0236 | Isolate | Apidae |
| 95 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 96 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 97 | 3300007190 | Ant gut microbial communities from Cephalotes umbraculatus, Peru | Metagenome | Formicidae |
| 98 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 99 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 100 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 101 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 102 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 103 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 104 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 105 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 106 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 107 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 108 | 2820785563 | Unclassified Bacteroidetes Emb289P1bin74 | Isolate | Unclassified |
| 109 | 2940193328 | Dysgonomonas sp. PH5-45 | Isolate | Blattidae |
| 110 | 2940248789 | Dysgonomonas sp. PF1-16 | Isolate | Blattidae |
| 111 | 2940346213 | Parabacteroides sp. PFB2-12 | Isolate | Blattidae |
| 112 | 2684622912 | Lactobacillus apis Lb_185 | Isolate | Unclassified |
| 113 | 2684622913 | Lactobacillus melliventris Lb_184 | Isolate | Unclassified |
| 114 | 2758568506 | Lactobacillus bombicola ESL0230 | Isolate | Unclassified |
| 115 | 2758568513 | Lactobacillus melliventris ESL0260 | Isolate | Unclassified |
| 116 | 2758568558 | Lactobacillus melliventris ESL0393 | Isolate | Unclassified |
| 117 | 2799112220 | Lactobacillus sp. ESL0411 | Isolate | Unclassified |
| 118 | 2814123166 | Lactobacillus apis LMG 26964 | Isolate | Apidae |
| 119 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 120 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 121 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 122 | 3004677695 | Bacteroides sp. 214 | Isolate | Blattidae |
| 123 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 124 | 3300005721 | Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 | Metagenome | Apidae |
| 125 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 126 | 3300012845 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG | Metagenome | Culicidae |
| 127 | 3300012848 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG | Metagenome | Armadillidiidae |
| 128 | 3300021240 | Termite gut microbial communities from nest from French Guiana - 11-5 mRNA SA | Metatranscriptome | Termitidae |
| 129 | 3300023282 | Termite gut microbial communities from Aparatermes sp. nest - French Guiana - 29-3 mRNA | Metatranscriptome | Termitidae |
| 130 | 2820765201 | Unclassified Bacteroidetes Lab288P3bin82 | Isolate | Unclassified |
| 131 | 2832298047 | Apibacter sp. wkB309 | Isolate | Apidae |
| 132 | 2910942425 | Dysgonomonas sp. 521 | Isolate | Blattidae |
| 133 | 2940244548 | Dysgonomonas sp. PF1-14 | Isolate | Blattidae |
| 134 | 2961515617 | Lactobacillus sp. ESL0259 | Isolate | Apidae |
| 135 | 2877513988 | Lactobacillus kullabergensis ESL0186 | Isolate | Apidae |
| 136 | 2225789003 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) | Metagenome | Passalidae |
| 137 | 2785510748 | Lactobacillus sp. ESL0409 | Isolate | Apidae |
| 138 | 2799112229 | Lactobacillus sp. ESL0413 | Isolate | Unclassified |
| 139 | 2799112230 | Lactobacillus sp. ESL0416 | Isolate | Unclassified |
| 140 | 2021593000 | Sample 264 | Metagenome | Harpacticidae |
| 141 | 8017440191 | Lactobacillus bombicola L5-31 | Isolate | Apidae |
| 142 | 8017462664 | Lactobacillus melliventris ESL0184 | Isolate | Apidae |
| 143 | 8100166142 | Dysgonomonas sp. GY75 | Isolate | Rhinotermitidae |
| 144 | 3004672520 | Bacteroides sp. 51 | Isolate | Blattidae |
| 145 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 146 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 147 | 3300022232 | Termite gut microbial communities from Cavitermes sp. nest - French Guiana - 28-9 mRNA | Metatranscriptome | Termitidae |
| 148 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 149 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 150 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 151 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 152 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 153 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 154 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 155 | 2899132286 | Myroides albus BIT-d1 | Isolate | Tenebrionidae |
| 156 | 2912324399 | Lactobacillus apis ESL0185 | Isolate | Apidae |
| 157 | 2922326829 | Bacteroides sp. 224 | Isolate | Blattidae |
| 158 | 2940253009 | Dysgonomonas sp. PF1-23 | Isolate | Blattidae |
| 159 | 2940257232 | Dysgonomonas sp. PFB1-18 | Isolate | Blattidae |
| 160 | 2695420317 | Dysgonomonas sp. HGC4 | Isolate | Unclassified |
| 161 | 2820671341 | Unclassified Firmicutes Co191P3bin20 | Isolate | Unclassified |
| 162 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 163 | 3300022820 | Termite gut microbial communities from Nasutitermes sp. nest - French Guiana - 36-11 mRNA | Metatranscriptome | Termitidae |
| 164 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 165 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 166 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466697_171567 | 3300042611 | Bacteria | 2992 |
| 2 | Ga0466697_222388 | 3300042611 | Unclassified | 1530 |
| 3 | Ga0466697_271579 | 3300042611 | Bacteria | 1199 |
| 4 | Ga0466733_013347 | 3300042659 | Bacteria | 6976 |
| 5 | Ga0466733_188673 | 3300042659 | Unclassified | 7150 |
| 6 | Ga0466710_360371 | 3300042613 | Bacteria | 5191 |
| 7 | Ga0466710_435809 | 3300042613 | Bacteria | 3899 |
| 8 | Ga0466711_103283 | 3300042615 | Bacteria | 1814 |
| 9 | Ga0466715_025469 | 3300042616 | Bacteria | 20577 |
| 10 | Ga0466718_062717 | 3300042617 | Bacteria | 1007 |
| 11 | Ga0466726_242160 | 3300042619 | Bacteria | 13880 |
| 12 | Ga0466729_117205 | 3300042621 | Bacteria | 50557 |
| 13 | Ga0466656_013690 | 3300042550 | Unclassified | 1236 |
| 14 | Ga0466657_388915 | 3300042582 | Bacteria | 3645 |
| 15 | Ga0466694_003944 | 3300042594 | Bacteria | 1725 |
| 16 | Ga0466729_226506 | 3300042621 | Bacteria | 10868 |
| 17 | Ga0466734_158837 | 3300042623 | Bacteria | 1241 |
| 18 | Ga0466735_199067 | 3300042624 | Bacteria | 3377 |
| 19 | Ga0466725_255972 | 3300042654 | Bacteria | 39464 |
| 20 | Ga0123356_10020734 | 3300010049 | Bacteria | 6216 |
| 21 | Ga0123356_10531087 | 3300010049 | Bacteria | 1336 |
| 22 | Ga0123353_10367522 | 3300010167 | Bacteria | 2158 |
| 23 | Ga0123353_10392289 | 3300010167 | Bacteria | 2070 |
| 24 | Ga0123354_10210181 | 3300010882 | Bacteria | 2106 |
| 25 | Ga0123354_10225873 | 3300010882 | Bacteria | 1973 |
| 26 | Ga0466701_036012 | 3300042598 | Bacteria | 5947 |
| 27 | Ga0466701_036305 | 3300042598 | Bacteria | 2727 |
| 28 | Ga0466701_038225 | 3300042598 | Bacteria | 12164 |
| 29 | Ga0466701_060634 | 3300042598 | Bacteria | 3386 |
| 30 | Ga0466701_087824 | 3300042598 | Unclassified | 1005 |
| 31 | Ga0466707_098650 | 3300042601 | Bacteria | 10173 |
| 32 | Ga0466713_027800 | 3300042602 | Bacteria | 40167 |
| 33 | Ga0466720_033681 | 3300042607 | Bacteria | 2172 |
| 34 | Ga0466722_073972 | 3300042609 | Bacteria | 128406 |
| 35 | 2227071638 | 2225789003 | Bacteria | 2600 |
| 36 | 2227256381 | 2225789004 | Bacteria | 1308 |
| 37 | 2227491320 | 2225789004 | Bacteria | 4075 |
| 38 | IMNBL1DRAFT_c0001224 | 3300000062 | Bacteria | 19401 |
| 39 | IMNBL1DRAFT_c0058981 | 3300000062 | Bacteria | 1163 |
| 40 | JGI24702J35022_10015899 | 3300002462 | Bacteria | 4132 |
| 41 | JGI24702J35022_10476861 | 3300002462 | Bacteria | 763 |
| 42 | JGI24702J35022_10483191 | 3300002462 | Bacteria | 758 |
| 43 | Ga0068302_10124393 | 3300005071 | Bacteria | 5305 |
| 44 | Ga0074278_136834 | 3300005721 | Bacteria | 1360 |
| 45 | Ga0103267_1000475 | 3300007190 | Bacteria | 22560 |
| 46 | Ga0466733_091282 | 3300042659 | Bacteria | 1842 |
| 47 | Ga0466733_220977 | 3300042659 | Bacteria | 23380 |
| 48 | Ga0562377_0004 | 3300056842 | Bacteria | 3525959 |
| 49 | Ga0466715_154449 | 3300042616 | Bacteria | 23802 |
| 50 | Ga0466715_595690 | 3300042616 | Bacteria | 7812 |
| 51 | Ga0466718_146676 | 3300042617 | Bacteria | 4038 |
| 52 | Ga0233288_1000587 | 3300022232 | Bacteria | 3311 |
| 53 | Ga0466656_294116 | 3300042550 | Bacteria | 2279 |
| 54 | Ga0466696_466060 | 3300042596 | Bacteria | 1015 |
| 55 | Ga0466735_017392 | 3300042624 | Bacteria | 4485 |
| 56 | Ga0466703_352292 | 3300042636 | Bacteria | 1489 |
| 57 | Ga0466704_134293 | 3300042643 | Bacteria | 13368 |
| 58 | Ga0466724_68870 | 3300042649 | Bacteria | 1283 |
| 59 | Ga0123355_10000469 | 3300009826 | Bacteria | 53443 |
| 60 | Ga0123355_10002506 | 3300009826 | Bacteria | 26020 |
| 61 | Ga0123356_10202491 | 3300010049 | Bacteria | 2026 |
| 62 | Ga0123356_11664197 | 3300010049 | Unclassified | 791 |
| 63 | Ga0123356_12013372 | 3300010049 | Unclassified | 720 |
| 64 | Ga0123353_10609944 | 3300010167 | Bacteria | 1557 |
| 65 | Ga0123354_10000498 | 3300010882 | Bacteria | 39457 |
| 66 | Ga0466700_396847 | 3300042600 | Unclassified | 3504 |
| 67 | Ga0466713_052484 | 3300042602 | Bacteria | 51192 |
| 68 | Ga0466714_113690 | 3300042603 | Bacteria | 1554 |
| 69 | Ga0466721_140437 | 3300042608 | Bacteria | 2512 |
| 70 | IMNBL1DRAFT_c0049412 | 3300000062 | Bacteria | 1341 |
| 71 | JGI24702J35022_10002652 | 3300002462 | Bacteria | 10856 |
| 72 | JGI24702J35022_10081541 | 3300002462 | Unclassified | 1753 |
| 73 | JGI24702J35022_10427277 | 3300002462 | Bacteria | 804 |
| 74 | JGI24702J35022_10807958 | 3300002462 | Bacteria | 584 |
| 75 | JGI24696J40584_12431188 | 3300002834 | Bacteria | 567 |
| 76 | Ga0104048_1024507 | 3300007143 | Bacteria | 1811 |
| 77 | Ga0104048_1169657 | 3300007143 | Unclassified | 1944 |
| 78 | Ga0466705_222636 | 3300042612 | Bacteria | 3771 |
| 79 | Ga0466733_052339 | 3300042659 | Bacteria | 35317 |
| 80 | Ga0466715_045203 | 3300042616 | Bacteria | 21834 |
| 81 | Ga0466723_196307 | 3300042618 | Bacteria | 2425 |
| 82 | Ga0466723_198099 | 3300042618 | Bacteria | 9283 |
| 83 | Ga0466728_294355 | 3300042620 | Bacteria | 3426 |
| 84 | Ga0264413_160442 | 3300024493 | Unclassified | 982 |
| 85 | Ga0466657_367532 | 3300042582 | Unclassified | 1171 |
| 86 | Ga0466657_396906 | 3300042582 | Bacteria | 1226 |
| 87 | Ga0466690_287618 | 3300042590 | Bacteria | 16965 |
| 88 | Ga0466694_006142 | 3300042594 | Bacteria | 1075 |
| 89 | Ga0466694_145437 | 3300042594 | Unclassified | 1026 |
| 90 | Ga0466695_272796 | 3300042595 | Bacteria | 4403 |
| 91 | Ga0466699_227137 | 3300042597 | Unclassified | 1483 |
| 92 | Ga0466699_243824 | 3300042597 | Bacteria | 3177 |
| 93 | Ga0466734_063656 | 3300042623 | Bacteria | 2735 |
| 94 | Ga0466735_152196 | 3300042624 | Bacteria | 3972 |
| 95 | Ga0466735_164481 | 3300042624 | Bacteria | 11213 |
| 96 | Ga0466735_166733 | 3300042624 | Unclassified | 1570 |
| 97 | Ga0466730_084715 | 3300042625 | Bacteria | 2994 |
| 98 | Ga0466702_229598 | 3300042635 | Bacteria | 1647 |
| 99 | Ga0466704_541626 | 3300042643 | Bacteria | 3198 |
| 100 | Ga0466709_406939 | 3300042648 | Bacteria | 144693 |
| 101 | Ga0466725_021933 | 3300042654 | Bacteria | 1077 |
| 102 | Ga0466725_213877 | 3300042654 | Bacteria | 2875 |
| 103 | Ga0123356_10824572 | 3300010049 | Bacteria | 1099 |
| 104 | Ga0466717_090799 | 3300042604 | Bacteria | 1304 |
| 105 | Ga0466716_421833 | 3300042605 | Bacteria | 2093 |
| 106 | Ga0466721_149392 | 3300042608 | Unclassified | 1131 |
| 107 | Ga0466722_086030 | 3300042609 | Bacteria | 5720 |
| 108 | Ga0466698_439910 | 3300042610 | Bacteria | 1160 |
| 109 | 2227606019 | 2225789004 | Bacteria | 2298 |
| 110 | IMNBL1DRAFT_c0007028 | 3300000062 | Bacteria | 6005 |
| 111 | JGI24695J34938_10039258 | 3300002450 | Bacteria | 2140 |
| 112 | JGI24702J35022_10000547 | 3300002462 | Bacteria | 22726 |
| 113 | JGI24702J35022_10020509 | 3300002462 | Bacteria | 3587 |
| 114 | Ga0068305_10002308 | 3300005083 | Bacteria | 45236 |
| 115 | Ga0068305_10026156 | 3300005083 | Bacteria | 20761 |
| 116 | Ga0466697_150762 | 3300042611 | Bacteria | 1109 |
| 117 | Ga0466732_141961 | 3300042656 | Unclassified | 4820 |
| 118 | Ga0466733_132245 | 3300042659 | Bacteria | 2692 |
| 119 | Ga0466705_525713 | 3300042612 | Bacteria | 1726 |
| 120 | Ga0466715_016723 | 3300042616 | Bacteria | 13247 |
| 121 | Ga0466718_119526 | 3300042617 | Bacteria | 1899 |
| 122 | Ga0466723_058528 | 3300042618 | Bacteria | 28595 |
| 123 | Ga0255809_1015644 | 3300022820 | Unclassified | 557 |
| 124 | Ga0264413_138535 | 3300024493 | Unclassified | 14446 |
| 125 | Ga0466690_168212 | 3300042590 | Bacteria | 11803 |
| 126 | Ga0466693_175010 | 3300042592 | Bacteria | 10069 |
| 127 | Ga0466691_204814 | 3300042593 | Bacteria | 23707 |
| 128 | Ga0466695_112952 | 3300042595 | Bacteria | 2140 |
| 129 | Ga0466695_394828 | 3300042595 | Bacteria | 6915 |
| 130 | Ga0466731_050866 | 3300042622 | Bacteria | 13115 |
| 131 | Ga0466731_370304 | 3300042622 | Bacteria | 1271 |
| 132 | Ga0466735_027088 | 3300042624 | Bacteria | 1487 |
| 133 | Ga0466735_177951 | 3300042624 | Bacteria | 10162 |
| 134 | Ga0466702_406892 | 3300042635 | Bacteria | 4112 |
| 135 | Ga0466704_051937 | 3300042643 | Bacteria | 1091 |
| 136 | Ga0123356_10073866 | 3300010049 | Bacteria | 3208 |
| 137 | Ga0123356_12150010 | 3300010049 | Bacteria | 697 |
| 138 | Ga0123353_10820437 | 3300010167 | Unclassified | 1281 |
| 139 | Ga0123353_10870821 | 3300010167 | Bacteria | 1231 |
| 140 | Ga0466706_123047 | 3300042599 | Bacteria | 432554 |
| 141 | Ga0466706_198004 | 3300042599 | Bacteria | 4840 |
| 142 | Ga0466700_058068 | 3300042600 | Bacteria | 2019 |
| 143 | Ga0466707_315151 | 3300042601 | Bacteria | 79442 |
| 144 | Ga0466714_088188 | 3300042603 | Bacteria | 2351 |
| 145 | Ga0466714_137899 | 3300042603 | Unclassified | 4179 |
| 146 | Ga0466717_033155 | 3300042604 | Bacteria | 1231 |
| 147 | Ga0466722_161726 | 3300042609 | Bacteria | 14778 |
| 148 | Ga0466698_105271 | 3300042610 | Bacteria | 33608 |
| 149 | JGI24698J34947_10000555 | 3300002449 | Bacteria | 17744 |
| 150 | JGI24695J34938_10003848 | 3300002450 | Bacteria | 10185 |
| 151 | JGI24702J35022_10022268 | 3300002462 | Bacteria | 3432 |
| 152 | JGI24702J35022_10023308 | 3300002462 | Bacteria | 3347 |
| 153 | JGI24702J35022_10430787 | 3300002462 | Bacteria | 801 |
| 154 | JGI24705J35276_12214984 | 3300002504 | Bacteria | 1983 |
| 155 | Ga0105005_1046106 | 3300007505 | Bacteria | 1473 |
| 156 | Ga0466733_042896 | 3300042659 | Unclassified | 1702 |
| 157 | Ga0466733_177289 | 3300042659 | Unclassified | 1004 |
| 158 | Ga0466710_087835 | 3300042613 | Bacteria | 1266 |
| 159 | Ga0466715_233174 | 3300042616 | Bacteria | 1175 |
| 160 | Ga0466726_037110 | 3300042619 | Bacteria | 18134 |
| 161 | Ga0264413_158905 | 3300024493 | Bacteria | 1879 |
| 162 | Ga0466693_078533 | 3300042592 | Bacteria | 2944 |
| 163 | Ga0466696_005318 | 3300042596 | Bacteria | 52289 |
| 164 | Ga0466735_034406 | 3300042624 | Bacteria | 4957 |
| 165 | Ga0466735_069412 | 3300042624 | Bacteria | 1697 |
| 166 | Ga0466704_477103 | 3300042643 | Bacteria | 9640 |
| 167 | Ga0466724_68043 | 3300042649 | Bacteria | 1234 |
| 168 | Ga0466727_050462 | 3300042655 | Bacteria | 20965 |
| 169 | Ga0123355_10194254 | 3300009826 | Bacteria | 2980 |
| 170 | Ga0123356_10069677 | 3300010049 | Bacteria | 3298 |
| 171 | Ga0123356_10115768 | 3300010049 | Bacteria | 2598 |
| 172 | Ga0123356_11703014 | 3300010049 | Unclassified | 782 |
| 173 | Ga0123356_13331084 | 3300010049 | Unclassified | 558 |
| 174 | Ga0123353_10000175 | 3300010167 | Bacteria | 81609 |
| 175 | Ga0123353_11160268 | 3300010167 | Unclassified | 1018 |
| 176 | Ga0123353_12525121 | 3300010167 | Unclassified | 610 |
| 177 | Ga0123354_10352651 | 3300010882 | Unclassified | 1309 |
| 178 | Ga0466706_051732 | 3300042599 | Bacteria | 31564 |
| 179 | Ga0466706_183911 | 3300042599 | Bacteria | 19618 |
| 180 | Ga0466713_007584 | 3300042602 | Bacteria | 12665 |
| 181 | Ga0466713_018853 | 3300042602 | Bacteria | 13634 |
| 182 | Ga0466713_030797 | 3300042602 | Bacteria | 38314 |
| 183 | Ga0466714_035260 | 3300042603 | Bacteria | 6508 |
| 184 | Ga0466719_152619 | 3300042606 | Bacteria | 6002 |
| 185 | Ga0466719_381451 | 3300042606 | Bacteria | 3784 |
| 186 | Ga0466720_051698 | 3300042607 | Bacteria | 1551 |
| 187 | Ga0466720_119454 | 3300042607 | Bacteria | 1177 |
| 188 | TM1208_contig56605 | 2021593000 | Bacteria | 855 |
| 189 | JGI24702J35022_10000840 | 3300002462 | Bacteria | 18966 |
| 190 | JGI24696J40584_12814696 | 3300002834 | Unclassified | 895 |
| 191 | Ga0123357_10000330 | 3300009784 | Bacteria | 44905 |
| 192 | Ga0466697_074154 | 3300042611 | Unclassified | 1328 |
| 193 | Ga0466732_436750 | 3300042656 | Bacteria | 1695 |
| 194 | Ga0466733_169758 | 3300042659 | Bacteria | 1193 |
| 195 | Ga0466710_153421 | 3300042613 | Bacteria | 1718 |
| 196 | Ga0466710_319466 | 3300042613 | Bacteria | 1153 |
| 197 | Ga0466711_464836 | 3300042615 | Bacteria | 36759 |
| 198 | Ga0466715_209992 | 3300042616 | Bacteria | 7477 |
| 199 | Ga0160443_100370 | 3300012848 | Bacteria | 37848 |
| 200 | Ga0223684_1051054 | 3300021240 | Bacteria | 608 |
| 201 | Ga0466657_360416 | 3300042582 | Bacteria | 25893 |
| 202 | Ga0466690_085991 | 3300042590 | Bacteria | 12516 |
| 203 | Ga0466690_147457 | 3300042590 | Bacteria | 20788 |
| 204 | Ga0466692_137912 | 3300042591 | Bacteria | 2313 |
| 205 | Ga0466695_330118 | 3300042595 | Bacteria | 3346 |
| 206 | Ga0466696_199358 | 3300042596 | Bacteria | 7259 |
| 207 | Ga0466696_247964 | 3300042596 | Bacteria | 1348 |
| 208 | Ga0466696_258996 | 3300042596 | Bacteria | 2499 |
| 209 | Ga0466731_294011 | 3300042622 | Bacteria | 4113 |
| 210 | Ga0466735_014487 | 3300042624 | Bacteria | 7098 |
| 211 | Ga0466702_138136 | 3300042635 | Unclassified | 1906 |
| 212 | Ga0466703_073446 | 3300042636 | Bacteria | 8423 |
| 213 | Ga0466703_367008 | 3300042636 | Bacteria | 30950 |
| 214 | Ga0466725_237462 | 3300042654 | Unclassified | 1136 |
| 215 | Ga0123357_10473530 | 3300009784 | Bacteria | 1065 |
| 216 | Ga0123355_10098764 | 3300009826 | Bacteria | 4603 |
| 217 | Ga0123356_10118653 | 3300010049 | Bacteria | 2569 |
| 218 | Ga0123353_10000124 | 3300010167 | Bacteria | 92555 |
| 219 | Ga0123353_11012372 | 3300010167 | Unclassified | 1115 |
| 220 | Ga0123353_11325684 | 3300010167 | Bacteria | 932 |
| 221 | Ga0123354_10001124 | 3300010882 | Bacteria | 31160 |
| 222 | Ga0123354_10335090 | 3300010882 | Bacteria | 1373 |
| 223 | Ga0466706_218384 | 3300042599 | Bacteria | 1982 |
| 224 | Ga0466706_228754 | 3300042599 | Bacteria | 25710 |
| 225 | Ga0466713_017440 | 3300042602 | Bacteria | 108493 |
| 226 | Ga0466714_061452 | 3300042603 | Bacteria | 2603 |
| 227 | Ga0466717_235136 | 3300042604 | Unclassified | 1031 |
| 228 | Ga0466722_256378 | 3300042609 | Bacteria | 7727 |
| 229 | Ga0466698_327264 | 3300042610 | Bacteria | 8551 |
| 230 | Ga0466698_392141 | 3300042610 | Bacteria | 2397 |
| 231 | IMNBL1DRAFT_c0004898 | 3300000062 | Bacteria | 7855 |
| 232 | JGI24702J35022_10078783 | 3300002462 | Bacteria | 1783 |
| 233 | JGI24702J35022_10098556 | 3300002462 | Bacteria | 1598 |
| 234 | JGI24702J35022_10925438 | 3300002462 | Unclassified | 543 |
| 235 | JGI24705J35276_12054925 | 3300002504 | Bacteria | 925 |
| 236 | JGI24699J35502_11134150 | 3300002509 | Bacteria | 37878 |
| 237 | JGI24696J40584_12858116 | 3300002834 | Unclassified | 1002 |
| 238 | Ga0068305_10001103 | 3300005083 | Bacteria | 12271 |
| 239 | Ga0068305_10200441 | 3300005083 | Bacteria | 1096 |
| 240 | Ga0466697_129165 | 3300042611 | Bacteria | 1022 |
| 241 | Ga0466697_240388 | 3300042611 | Bacteria | 1604 |
| 242 | Ga0466733_062198 | 3300042659 | Bacteria | 1235 |
| 243 | Ga0466710_181731 | 3300042613 | Bacteria | 1152 |
| 244 | Ga0466711_289238 | 3300042615 | Bacteria | 45865 |
| 245 | Ga0466723_027283 | 3300042618 | Bacteria | 8488 |
| 246 | Ga0466729_114753 | 3300042621 | Bacteria | 4530 |
| 247 | Ga0160460_100001 | 3300012845 | Bacteria | 905098 |
| 248 | Ga0255809_1020061 | 3300022820 | Unclassified | 548 |
| 249 | Ga0255808_1004113 | 3300023282 | Bacteria | 1516 |
| 250 | Ga0466694_170101 | 3300042594 | Unclassified | 1382 |
| 251 | Ga0466696_206041 | 3300042596 | Bacteria | 1521 |
| 252 | Ga0466696_367210 | 3300042596 | Bacteria | 9324 |
| 253 | Ga0466731_316999 | 3300042622 | Bacteria | 1703 |
| 254 | Ga0466734_102724 | 3300042623 | Bacteria | 2099 |
| 255 | Ga0466735_172430 | 3300042624 | Bacteria | 13043 |
| 256 | Ga0466735_180421 | 3300042624 | Bacteria | 2530 |
| 257 | Ga0466703_083810 | 3300042636 | Unclassified | 2288 |
| 258 | Ga0466724_39918 | 3300042649 | Bacteria | 1216 |
| 259 | Ga0123357_10316724 | 3300009784 | Unclassified | 1548 |
| 260 | Ga0123356_10441924 | 3300010049 | Bacteria | 1447 |
| 261 | Ga0123356_11153446 | 3300010049 | Bacteria | 942 |
| 262 | Ga0123353_10062736 | 3300010167 | Bacteria | 5960 |
| 263 | Ga0123353_10076527 | 3300010167 | Bacteria | 5377 |
| 264 | Ga0123353_11666204 | 3300010167 | Bacteria | 801 |
| 265 | Ga0466707_398960 | 3300042601 | Bacteria | 15809 |
| 266 | Ga0466713_137191 | 3300042602 | Bacteria | 44160 |
| 267 | Ga0466698_062035 | 3300042610 | Bacteria | 1945 |
| 268 | Ga0466698_248722 | 3300042610 | Bacteria | 1594 |
| 269 | Ga0466697_012625 | 3300042611 | Bacteria | 1136 |
| 270 | 2227073312 | 2225789003 | Bacteria | 2462 |
| 271 | IMNBL1DRAFT_c0000687 | 3300000062 | Bacteria | 27159 |
| 272 | IMNBL1DRAFT_c0022374 | 3300000062 | Bacteria | 2503 |
| 273 | IMNBL1DRAFT_c0143729 | 3300000062 | Unclassified | 615 |
| 274 | JGI24698J34947_10043085 | 3300002449 | Bacteria | 2315 |
| 275 | JGI24698J34947_10051090 | 3300002449 | Bacteria | 2081 |
| 276 | Ga0072941_1219958 | 3300005201 | Bacteria | 2247 |
| 277 | Ga0074304_1139657 | 3300005319 | Bacteria | 1821 |
| 278 | Ga0103267_1000167 | 3300007190 | Bacteria | 33708 |
| 279 | Ga0466733_122413 | 3300042659 | Bacteria | 26318 |
| 280 | Ga0466710_038969 | 3300042613 | Bacteria | 1095 |
| 281 | Ga0466711_373674 | 3300042615 | Bacteria | 10875 |
| 282 | Ga0466715_128269 | 3300042616 | Bacteria | 2365 |
| 283 | Ga0466726_144476 | 3300042619 | Bacteria | 21004 |
| 284 | Ga0264413_160170 | 3300024493 | Bacteria | 2721 |
| 285 | Ga0415639_246410 | 3300038395 | Bacteria | 1476 |
| 286 | Ga0466656_221111 | 3300042550 | Bacteria | 1253 |
| 287 | Ga0466690_136616 | 3300042590 | Bacteria | 29160 |
| 288 | Ga0466692_194374 | 3300042591 | Unclassified | 2038 |
| 289 | Ga0466693_068969 | 3300042592 | Bacteria | 6191 |
| 290 | Ga0466694_385058 | 3300042594 | Bacteria | 6267 |
| 291 | Ga0466696_466695 | 3300042596 | Bacteria | 1016 |
| 292 | Ga0466699_221782 | 3300042597 | Bacteria | 1016 |
| 293 | Ga0466729_310854 | 3300042621 | Bacteria | 3061 |
| 294 | Ga0466735_174105 | 3300042624 | Unclassified | 1137 |
| 295 | Ga0466735_207348 | 3300042624 | Bacteria | 2404 |
| 296 | Ga0466735_221794 | 3300042624 | Bacteria | 2360 |
| 297 | Ga0466703_109702 | 3300042636 | Bacteria | 21153 |
| 298 | Ga0466703_388735 | 3300042636 | Bacteria | 2070 |
| 299 | Ga0466709_083357 | 3300042648 | Bacteria | 39489 |
| 300 | Ga0466727_230520 | 3300042655 | Bacteria | 1042 |
| 301 | Ga0123357_10030639 | 3300009784 | Bacteria | 7293 |
| 302 | Ga0123355_10301947 | 3300009826 | Bacteria | 2181 |
| 303 | Ga0123356_10020898 | 3300010049 | Bacteria | 6193 |
| 304 | Ga0123356_11972080 | 3300010049 | Unclassified | 728 |
| 305 | Ga0466701_068382 | 3300042598 | Unclassified | 3382 |
| 306 | Ga0466707_194386 | 3300042601 | Bacteria | 27039 |
| 307 | Ga0466713_096596 | 3300042602 | Bacteria | 406546 |
| 308 | Ga0466698_113235 | 3300042610 | Bacteria | 1753 |
| 309 | IMNBL1DRAFT_c0032731 | 3300000062 | Bacteria | 1871 |
| 310 | JGI24702J35022_10008763 | 3300002462 | Bacteria | 5711 |
| 311 | Ga0068302_10187713 | 3300005071 | Bacteria | 5235 |
| 312 | Ga0104040_1000171 | 3300007149 | Bacteria | 2406 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00366 | Ribosomal_S17 | Ribosomal protein S17 | 29 | 96 | 0.99 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.