Protein Family IF06582
Metagenome
Isolate
153
Members
67
Samples
131
Scaffolds
315.14
Avg Length
Representative Sequence
- ID
- 3300042606|Ga0466719_433976|Ga0466719_433976_235_1275
- Length
- 346 aa
- Sequence
- MAEKIATRHAYGEALAELGAVNKRVVALDADVSTCTMSCIFGEKYPDRFYNVGIAEANMVGIAAGMSTTGLIPFVHSFAMFTAGRTFDQIRNSLAYPHLNVKVVGTHSGLTVGEDGATHQCLEDIGIMRTIPNLVVVCPCDGNETQAAVQAIAEYDGPVYLRLGRLALETVTDRPDYSFKLGKSVVMQDGGDVTIIATGLMVQEALAAAKLLAGEGIKARVLDMHTIKPLDTEAVLKAARETGAIVTAEEHNIIGGLGGAVAEIVSGSIPVPVLRVGTEDTFGRSGNGEKLLIKYGLTKENIALKAKQAIGLRRTLGVYSRTFSAEIVRKLKVFALPYFICIYYCR
Sample Types
Isolate
14.4%
Metagenome
85.6%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
29.7%
Kalotermitidae
21.9%
Unclassified
18.8%
Coreidae
17.2%
Rhinotermitidae
4.7%
Passalidae
1.6%
Termopsidae
1.6%
Stratiomyidae
1.6%
Formicidae
1.6%
Hodotermitidae
1.6%
Taxonomy
Archaea
0
Bacteria
135
Eukaryota
0
Viruses
0
Unclassified
18
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820336130 | Unclassified Firmicutes Nt197P3bin70 | Isolate | Unclassified |
| 2 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 3 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 4 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 5 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 6 | 8023764196 | Caballeronia peredens LZ001 | Isolate | Coreidae |
| 7 | 8025728939 | Caballeronia telluris LZ024 | Isolate | Coreidae |
| 8 | 8025747911 | Caballeronia peredens LZ003 | Isolate | Coreidae |
| 9 | 8069755105 | Caballeronia sp. LZ003 | Isolate | Coreidae |
| 10 | 3006461590 | Streptomyces sp. RB5 | Isolate | Termitidae |
| 11 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 12 | 2820551407 | Unclassified Firmicutes Emb289P4bin38 | Isolate | Unclassified |
| 13 | 2820594669 | Unclassified Firmicutes Emb289P1bin61 | Isolate | Unclassified |
| 14 | 2820606014 | Unclassified Firmicutes Emb289P1bin49 | Isolate | Unclassified |
| 15 | 2820788205 | Unclassified Bacteroidetes Emb289P1bin57 | Isolate | Unclassified |
| 16 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 17 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 18 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 19 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 20 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 21 | 8025756023 | Caballeronia peredens LZ002 | Isolate | Coreidae |
| 22 | 8102161003 | Caballeronia sp. LZ002 | Isolate | Coreidae |
| 23 | 8102174626 | Caballeronia sp. LZ024 | Isolate | Coreidae |
| 24 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 25 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 26 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 27 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 28 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 29 | 3300012834 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG | Metagenome | |
| 30 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 31 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 32 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 33 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 34 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 35 | 2820785563 | Unclassified Bacteroidetes Emb289P1bin74 | Isolate | Unclassified |
| 36 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 37 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 38 | 2820408893 | Unclassified Firmicutes Lab288P4bin80 | Isolate | Unclassified |
| 39 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 40 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 41 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 42 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 43 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 44 | 2820252425 | Unclassified Firmicutes Th196P3bin6 | Isolate | Unclassified |
| 45 | 2820702360 | Unclassified Firmicutes Co191P1bin4 | Isolate | Unclassified |
| 46 | 8025701579 | Caballeronia telluris LZ031 | Isolate | Coreidae |
| 47 | 8030343600 | Proteiniborus sp. MB09-C3 | Isolate | Stratiomyidae |
| 48 | 8102041249 | Caballeronia sp. GACF4 | Isolate | Coreidae |
| 49 | 8102201977 | Caballeronia sp. LZ031 | Isolate | Coreidae |
| 50 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 51 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 52 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 53 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 54 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 55 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 56 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 57 | 8102152052 | Caballeronia sp. LZ001 | Isolate | Coreidae |
| 58 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 59 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 60 | 3300007190 | Ant gut microbial communities from Cephalotes umbraculatus, Peru | Metagenome | Formicidae |
| 61 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 62 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 63 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 64 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 65 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 66 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 67 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466707_165640 | 3300042601 | Bacteria | 4904 |
| 2 | Ga0466703_141218 | 3300042636 | Bacteria | 9072 |
| 3 | Ga0466704_171370 | 3300042643 | Unclassified | 7893 |
| 4 | Ga0466704_286019 | 3300042643 | Bacteria | 7512 |
| 5 | Ga0466708_427818 | 3300042652 | Bacteria | 41992 |
| 6 | Ga0466705_388032 | 3300042612 | Unclassified | 2906 |
| 7 | Ga0466711_226562 | 3300042615 | Bacteria | 17391 |
| 8 | Ga0466711_258963 | 3300042615 | Unclassified | 2557 |
| 9 | Ga0466728_471447 | 3300042620 | Unclassified | 2080 |
| 10 | Ga0123355_10051306 | 3300009826 | Bacteria | 6696 |
| 11 | Ga0123355_10681035 | 3300009826 | Bacteria | 1188 |
| 12 | Ga0072941_1082739 | 3300005201 | Bacteria | 4157 |
| 13 | Ga0466705_014239 | 3300042612 | Bacteria | 6971 |
| 14 | Ga0466701_026131 | 3300042598 | Bacteria | 1711 |
| 15 | Ga0466731_230741 | 3300042622 | Bacteria | 2236 |
| 16 | Ga0466702_456240 | 3300042635 | Bacteria | 2342 |
| 17 | Ga0466709_004469 | 3300042648 | Bacteria | 5612 |
| 18 | Ga0466728_235824 | 3300042620 | Unclassified | 6889 |
| 19 | Ga0466728_415095 | 3300042620 | Bacteria | 18180 |
| 20 | Ga0415639_033646 | 3300038395 | Bacteria | 4722 |
| 21 | Ga0466692_022127 | 3300042591 | Bacteria | 1282 |
| 22 | Ga0466696_450945 | 3300042596 | Bacteria | 1562 |
| 23 | Ga0123355_10081582 | 3300009826 | Unclassified | 5161 |
| 24 | Ga0123355_10280731 | 3300009826 | Bacteria | 2300 |
| 25 | Ga0123355_10500889 | 3300009826 | Bacteria | 1498 |
| 26 | Ga0123356_10351478 | 3300010049 | Unclassified | 1598 |
| 27 | Ga0123353_10534099 | 3300010167 | Bacteria | 1697 |
| 28 | Ga0123354_10044126 | 3300010882 | Bacteria | 6843 |
| 29 | IMNBL1DRAFT_c0000408 | 3300000062 | Bacteria | 36415 |
| 30 | Ga0123357_10000472 | 3300009784 | Bacteria | 39208 |
| 31 | Ga0466706_039965 | 3300042599 | Bacteria | 2017 |
| 32 | Ga0466734_173908 | 3300042623 | Bacteria | 7096 |
| 33 | Ga0466709_111220 | 3300042648 | Bacteria | 20591 |
| 34 | Ga0466723_351299 | 3300042618 | Bacteria | 1919 |
| 35 | Ga0466696_116142 | 3300042596 | Unclassified | 1307 |
| 36 | Ga0123355_10136505 | 3300009826 | Bacteria | 3766 |
| 37 | Ga0123353_10096280 | 3300010167 | Unclassified | 4770 |
| 38 | Ga0123354_10122402 | 3300010882 | Bacteria | 3349 |
| 39 | IMNBL1DRAFT_c0007850 | 3300000062 | Bacteria | 5535 |
| 40 | AustNasuHG_c1002946 | 3300000089 | Bacteria | 6131 |
| 41 | Ga0072940_1087722 | 3300005200 | Bacteria | 3275 |
| 42 | Ga0466716_402194 | 3300042605 | Bacteria | 2690 |
| 43 | Ga0466722_217988 | 3300042609 | Bacteria | 3334 |
| 44 | Ga0466704_060326 | 3300042643 | Bacteria | 6557 |
| 45 | Ga0466704_161810 | 3300042643 | Bacteria | 6733 |
| 46 | Ga0466709_020128 | 3300042648 | Bacteria | 13935 |
| 47 | Ga0466708_095771 | 3300042652 | Bacteria | 7669 |
| 48 | Ga0466715_375162 | 3300042616 | Bacteria | 1704 |
| 49 | Ga0264413_115241 | 3300024493 | Bacteria | 2198 |
| 50 | Ga0466690_249938 | 3300042590 | Bacteria | 1694 |
| 51 | Ga0466693_031691 | 3300042592 | Unclassified | 1743 |
| 52 | Ga0123357_10443148 | 3300009784 | Bacteria | 1134 |
| 53 | Ga0123355_10000308 | 3300009826 | Bacteria | 62784 |
| 54 | Ga0123355_10004665 | 3300009826 | Bacteria | 19954 |
| 55 | Ga0123355_10279966 | 3300009826 | Unclassified | 2304 |
| 56 | Ga0123355_10624039 | 3300009826 | Bacteria | 1269 |
| 57 | Ga0123353_10706758 | 3300010167 | Bacteria | 1413 |
| 58 | Ga0123354_10012104 | 3300010882 | Bacteria | 13358 |
| 59 | Ga0466705_176249 | 3300042612 | Unclassified | 3508 |
| 60 | Ga0466707_214654 | 3300042601 | Bacteria | 2401 |
| 61 | Ga0466713_152398 | 3300042602 | Bacteria | 10289 |
| 62 | Ga0466716_124256 | 3300042605 | Bacteria | 3758 |
| 63 | Ga0466731_402386 | 3300042622 | Bacteria | 1349 |
| 64 | Ga0466703_161663 | 3300042636 | Bacteria | 2518 |
| 65 | Ga0466704_310573 | 3300042643 | Bacteria | 3397 |
| 66 | Ga0466711_216896 | 3300042615 | Bacteria | 77790 |
| 67 | Ga0466715_136964 | 3300042616 | Bacteria | 7730 |
| 68 | Ga0466718_082687 | 3300042617 | Bacteria | 1422 |
| 69 | Ga0466723_011041 | 3300042618 | Bacteria | 5457 |
| 70 | Ga0466726_404277 | 3300042619 | Bacteria | 3803 |
| 71 | Ga0160452_100573 | 3300012834 | Bacteria | 20900 |
| 72 | Ga0466690_175827 | 3300042590 | Bacteria | 2617 |
| 73 | Ga0466692_049933 | 3300042591 | Bacteria | 13665 |
| 74 | Ga0466696_316749 | 3300042596 | Bacteria | 6934 |
| 75 | Ga0123355_10486080 | 3300009826 | Bacteria | 1533 |
| 76 | Ga0123356_10013842 | 3300010049 | Bacteria | 7767 |
| 77 | Ga0123353_10774359 | 3300010167 | Bacteria | 1330 |
| 78 | Ga0103267_1000313 | 3300007190 | Bacteria | 24525 |
| 79 | Ga0466705_074709 | 3300042612 | Bacteria | 9023 |
| 80 | Ga0466732_218849 | 3300042656 | Bacteria | 2528 |
| 81 | Ga0466720_026307 | 3300042607 | Bacteria | 4790 |
| 82 | Ga0466722_214650 | 3300042609 | Bacteria | 1771 |
| 83 | Ga0466703_392859 | 3300042636 | Bacteria | 1245 |
| 84 | Ga0466709_075738 | 3300042648 | Bacteria | 16097 |
| 85 | Ga0466711_027766 | 3300042615 | Bacteria | 25508 |
| 86 | Ga0466711_312387 | 3300042615 | Bacteria | 16329 |
| 87 | Ga0466715_046010 | 3300042616 | Bacteria | 15636 |
| 88 | Ga0466726_072546 | 3300042619 | Bacteria | 2239 |
| 89 | Ga0466726_149558 | 3300042619 | Bacteria | 2897 |
| 90 | Ga0466726_442817 | 3300042619 | Unclassified | 10184 |
| 91 | Ga0466691_202286 | 3300042593 | Bacteria | 9198 |
| 92 | Ga0123355_10042225 | 3300009826 | Bacteria | 7423 |
| 93 | Ga0123355_10145614 | 3300009826 | Bacteria | 3613 |
| 94 | Ga0123356_10858387 | 3300010049 | Bacteria | 1079 |
| 95 | Ga0123353_10869987 | 3300010167 | Bacteria | 1232 |
| 96 | Ga0466716_286698 | 3300042605 | Unclassified | 10159 |
| 97 | Ga0466719_120600 | 3300042606 | Bacteria | 9653 |
| 98 | Ga0466719_433976 | 3300042606 | Bacteria | 2554 |
| 99 | Ga0466722_229243 | 3300042609 | Bacteria | 1915 |
| 100 | Ga0466703_013148 | 3300042636 | Bacteria | 2807 |
| 101 | Ga0466704_129490 | 3300042643 | Bacteria | 8235 |
| 102 | Ga0466708_077574 | 3300042652 | Bacteria | 1832 |
| 103 | Ga0466708_127930 | 3300042652 | Bacteria | 2509 |
| 104 | Ga0466718_169466 | 3300042617 | Bacteria | 3065 |
| 105 | Ga0466728_009688 | 3300042620 | Bacteria | 1647 |
| 106 | Ga0456237_0000239 | 3300041968 | Bacteria | 8002 |
| 107 | Ga0466691_110439 | 3300042593 | Unclassified | 3647 |
| 108 | Ga0466691_214386 | 3300042593 | Unclassified | 3014 |
| 109 | Ga0466707_354600 | 3300042601 | Bacteria | 1453 |
| 110 | Ga0466713_073334 | 3300042602 | Bacteria | 27069 |
| 111 | Ga0466722_049775 | 3300042609 | Bacteria | 13712 |
| 112 | Ga0466703_256104 | 3300042636 | Bacteria | 20139 |
| 113 | Ga0466724_65985 | 3300042649 | Bacteria | 3102 |
| 114 | Ga0466708_077581 | 3300042652 | Bacteria | 8574 |
| 115 | Ga0466708_296454 | 3300042652 | Bacteria | 54366 |
| 116 | Ga0466711_095982 | 3300042615 | Bacteria | 1390 |
| 117 | Ga0466711_230824 | 3300042615 | Bacteria | 16380 |
| 118 | Ga0466711_312963 | 3300042615 | Bacteria | 2242 |
| 119 | Ga0466715_135136 | 3300042616 | Bacteria | 8787 |
| 120 | Ga0466715_327919 | 3300042616 | Unclassified | 2128 |
| 121 | Ga0466723_176875 | 3300042618 | Bacteria | 1438 |
| 122 | Ga0466728_385286 | 3300042620 | Bacteria | 24912 |
| 123 | Ga0264413_135114 | 3300024493 | Bacteria | 31922 |
| 124 | Ga0466690_203536 | 3300042590 | Bacteria | 6431 |
| 125 | Ga0466690_248758 | 3300042590 | Bacteria | 30377 |
| 126 | Ga0466696_005409 | 3300042596 | Bacteria | 1491 |
| 127 | Ga0123355_10010996 | 3300009826 | Bacteria | 13929 |
| 128 | JGI24695J34938_10007798 | 3300002450 | Unclassified | 6203 |
| 129 | Ga0068305_10013464 | 3300005083 | Bacteria | 17688 |
| 130 | Ga0072940_1147130 | 3300005200 | Bacteria | 3525 |
| 131 | Ga0103267_1000534 | 3300007190 | Bacteria | 24328 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.