Protein Family IF06554

Metagenome Isolate
238 Members
93 Samples
197 Scaffolds
388.93 Avg Length

🧬 Representative Sequence

ID
3300042606|Ga0466719_325729|Ga0466719_325729_3197_4579
Length
460 aa
Sequence
MMLESGRTRKIAVLGSSGSIGRSALDVIALSQGTLEVVLLSVNRQTNILAEQLQQIAANIASNKLATNSVNKNQKNIMRMPQWIVVTDSDADRAPLEKLPSEILSETKIFYGQDSLSLLVREPEIDIVLSAVSGCAGLASTWSALEAGKIVALANKESLVSGGSMIKEVAEKNRGNLIPVDSEHSAVWQALQSWRMQHYPNSLINPDMNKTANKHSDLSLNPQNSACISVRQNVYNTDPRNVIDNITLTASGGPFRTWTLDELKKVTVTDALNHPTWKMGSKITVDSATMMNKAFEIIEASYLFDLDSCNIKVLIHPQSIVHSMVQFIDGSVVAQLSRPDMRIPISIALHYPERFELPVCPIDWSEKVSLEFYMPDFERFPAISLGYAVSDKGGTAGAVVNAANETAINAFLNGRLPFYDIVNACISVLENHNFEKRPTLSRLLELDTWARKETEKWISQ

📊 Sample Types

Isolate 17.2%
Metagenome 82.8%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 23.9%
Unclassified 19.6%
Kalotermitidae 15.2%
Elmidae 6.5%
Pyralidae 5.4%
Termopsidae 4.3%
Passalidae 3.3%
Rhinotermitidae 3.3%
Bombycidae 2.2%
Scarabaeidae 2.2%
Formicidae 2.2%
Portunidae 1.1%
Noctuidae 1.1%
Eresidae 1.1%
Culicidae 1.1%
Stratiomyidae 1.1%
Porcellionidae 1.1%
Ocypodidae 1.1%
Cimicidae 1.1%
Curculionidae 1.1%
Tenebrionidae 1.1%
Hodotermitidae 1.1%

🌳 Taxonomy

Archaea 0
Bacteria 227
Eukaryota 0
Viruses 0
Unclassified 11

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2864812326 Chitinimonas taiwanensis S00057 Isolate Elmidae
2 2864918810 Tsukamurella ocularis S00175 Isolate Elmidae
3 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
4 2820617402 Unclassified Firmicutes Emb289P1bin131 Isolate Unclassified
5 2820647881 Unclassified Firmicutes Cu122P5bin16 Isolate Unclassified
6 2969145278 Bacillus cereus 29 Isolate Portunidae
7 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
8 642555172 Endomicrobium trichonymphae Rs-D17 Isolate Unclassified
9 643886087 Bacillus thuringiensis sv. kurstaki T03a001 Isolate Pyralidae
10 643886090 Bacillus thuringiensis sv. pakistani t13001 Isolate Unclassified
11 8061100935 Bacillus thuringiensis sv. japonensis 62 Isolate
12 2864773010 Tsukamurella ocularis S00022 Isolate Elmidae
13 2563367190 Bacillus thuringiensis sv. aizawai Leapi01 Isolate Noctuidae
14 2772190894 Unclassified Elusimicrobia Th196P4_bin33 Isolate Unclassified
15 2820671341 Unclassified Firmicutes Co191P3bin20 Isolate Unclassified
16 3300002508 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 Metagenome Termitidae
17 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
18 8022725327 Bacillus sp. SN10 Isolate Eresidae
19 8022781829 Bacillus sp. VKPM B-3276 Isolate Culicidae
20 8030343600 Proteiniborus sp. MB09-C3 Isolate Stratiomyidae
21 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
22 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
23 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
24 2529293168 Ruminiclostridium cellobioparum termitidis CT1112 Isolate Termitidae
25 2820238527 Unclassified Firmicutes Th196P3bin90 Isolate Unclassified
26 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
27 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
28 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
29 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
30 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
31 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
32 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
33 8061039349 Bacillus thuringiensis sv. galleriae BGSC 4G4 Isolate Bombycidae
34 8073539042 Candidatus Rhabdochlamydia porcellionis 15C Isolate Porcellionidae
35 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
36 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
37 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
38 2537562000 Bacillus cereus HD73 Isolate Pyralidae
39 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
40 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
41 8061045771 Bacillus thuringiensis sv. kurstaki BGSC 4D1 Isolate Bombycidae
42 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
43 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
44 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
45 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
46 2822450720 Bacillus toyonensis AFS052650 Isolate Scarabaeidae
47 2864782175 Bacillus toyonensis S00025 Isolate Elmidae
48 2754412482 Unclassified Elusimicrobia Emb289P3bin85 Isolate Unclassified
49 2820171952 Unclassified Planctomycetes Th196P3bin88 Isolate Unclassified
50 2978778678 Bacillus cereus 25 Isolate Ocypodidae
51 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
52 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
53 646564587 Tsukamurella paurometabola 33, DSM 20162 Isolate Cimicidae
54 8077775691 Tsukamurella sp. PLM1 Isolate Formicidae
55 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
56 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
57 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
58 2822232166 Bacillus toyonensis AFS084242 Isolate Scarabaeidae
59 2225789003 Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) Metagenome Passalidae
60 2754412483 Unclassified Elusimicrobia Lab288P4bin38 Isolate Unclassified
61 2772190893 Unclassified Elusimicrobia Nt197P4_bin29 Isolate Unclassified
62 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
63 3300003973 Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle Metagenome Curculionidae
64 3300056856 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) Metagenome Tenebrionidae
65 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
66 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
67 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
68 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
69 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
70 2864964650 Tsukamurella ocularis S00236 Isolate Elmidae
71 2912849059 Bacillus thuringiensis sv. berliner ATCC 10792 Isolate Pyralidae
72 2820205024 Unclassified Planctomycetes Cu122P4bin3 Isolate Unclassified
73 2820306284 Unclassified Firmicutes Th196P1bin11 Isolate Unclassified
74 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
75 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
76 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
77 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
78 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
79 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
80 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
81 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
82 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
83 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
84 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
85 2864808494 Chitinimonas taiwanensis S00056 Isolate Elmidae
86 2820347164 Unclassified Firmicutes Nt197P3bin58 Isolate Unclassified
87 2820547636 Unclassified Firmicutes Lab288P1bin10 Isolate Unclassified
88 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
89 3300026558 Army ant gut microbial communities from Labidus praedator, Monteverde, Costa Rica - colony MVLprae1 Metagenome Formicidae
90 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
91 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
92 643886085 Bacillus thuringiensis sv. berliner ATCC 10792 Isolate Pyralidae
93 643886091 Bacillus thuringiensis sv. thuringiensis T01001 Isolate Pyralidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_377825 3300042612 Bacteria 346954
2 Ga0562375_0863 3300056856 Bacteria 50054
3 Ga0466702_198772 3300042635 Bacteria 2360
4 Ga0466704_336061 3300042643 Bacteria 3938
5 Ga0466725_043029 3300042654 Bacteria 10347
6 Ga0466705_467619 3300042612 Bacteria 4027
7 Ga0466711_270096 3300042615 Bacteria 3052
8 Ga0466715_114009 3300042616 Bacteria 13465
9 Ga0466723_046729 3300042618 Bacteria 2153
10 Ga0466728_250626 3300042620 Bacteria 18456
11 Ga0466729_065558 3300042621 Bacteria 5008
12 2227461360 2225789004 Bacteria 5351
13 IMNBL1DRAFT_c0008974 3300000062 Bacteria 5023
14 JGI24695J34938_10004084 3300002450 Bacteria 9752
15 Ga0466692_129576 3300042591 Bacteria 7783
16 Ga0466694_099253 3300042594 Bacteria 11689
17 Ga0466694_154038 3300042594 Bacteria 2154
18 Ga0466699_309712 3300042597 Bacteria 2152
19 Ga0466713_079335 3300042602 Bacteria 100418
20 Ga0466713_087792 3300042602 Bacteria 17055
21 Ga0466716_236915 3300042605 Bacteria 12284
22 Ga0466705_275974 3300042612 Bacteria 59097
23 Ga0123356_10000001 3300010049 Bacteria 411946
24 Ga0123356_10091749 3300010049 Bacteria 2896
25 Ga0123354_10000983 3300010882 Bacteria 32391
26 Ga0466735_038689 3300042624 Bacteria 6088
27 Ga0466735_044980 3300042624 Bacteria 12666
28 Ga0466704_118656 3300042643 Bacteria 31508
29 Ga0466704_500009 3300042643 Bacteria 11355
30 Ga0466705_433130 3300042612 Bacteria 4994
31 Ga0466710_103258 3300042613 Bacteria 3068
32 Ga0466710_345301 3300042613 Bacteria 3805
33 Ga0466715_290683 3300042616 Bacteria 15704
34 Ga0466723_089196 3300042618 Bacteria 18489
35 Ga0466726_204733 3300042619 Bacteria 56318
36 Ga0466726_427161 3300042619 Bacteria 8003
37 Ga0466729_035239 3300042621 Bacteria 10551
38 Ga0466729_069425 3300042621 Bacteria 2762
39 Ga0466729_172146 3300042621 Bacteria 14253
40 2227041496 2225789003 Bacteria 4177
41 Ga0068302_10003016 3300005071 Unclassified 7925
42 Ga0068302_10003017 3300005071 Bacteria 13145
43 Ga0068305_10000200 3300005083 Bacteria 53590
44 Ga0466690_028352 3300042590 Bacteria 80670
45 Ga0466691_080972 3300042593 Unclassified 3304
46 Ga0466696_010826 3300042596 Bacteria 7115
47 Ga0466696_182806 3300042596 Bacteria 2047
48 Ga0466716_152005 3300042605 Unclassified 19700
49 Ga0466719_126414 3300042606 Bacteria 59815
50 Ga0123356_10014972 3300010049 Bacteria 7441
51 Ga0466735_029069 3300042624 Bacteria 44652
52 Ga0466702_104040 3300042635 Bacteria 3062
53 Ga0466703_131108 3300042636 Unclassified 74792
54 Ga0466703_271965 3300042636 Bacteria 5815
55 Ga0466703_297371 3300042636 Bacteria 15802
56 Ga0466709_146781 3300042648 Bacteria 32108
57 Ga0466727_172156 3300042655 Bacteria 156225
58 Ga0466705_471806 3300042612 Bacteria 12054
59 Ga0466723_020100 3300042618 Bacteria 9430
60 Ga0466723_029076 3300042618 Bacteria 5616
61 Ga0466726_065940 3300042619 Bacteria 154230
62 Ga0466726_217236 3300042619 Bacteria 220873
63 Ga0466729_117205 3300042621 Bacteria 50557
64 Ga0063521_1005672 3300003973 Unclassified 2949
65 Ga0466691_017171 3300042593 Bacteria 24421
66 Ga0466707_111198 3300042601 Bacteria 45963
67 Ga0466707_344506 3300042601 Bacteria 2218
68 Ga0466722_202598 3300042609 Bacteria 2507
69 Ga0466705_081765 3300042612 Bacteria 5773
70 Ga0466702_318246 3300042635 Bacteria 3299
71 Ga0466703_156774 3300042636 Bacteria 6030
72 Ga0466704_058830 3300042643 Bacteria 7462
73 Ga0466704_219316 3300042643 Bacteria 28495
74 Ga0466704_372275 3300042643 Bacteria 54897
75 Ga0466704_375609 3300042643 Bacteria 17453
76 Ga0466727_277996 3300042655 Bacteria 60667
77 Ga0466727_332717 3300042655 Unclassified 8069
78 Ga0466711_330587 3300042615 Bacteria 18688
79 Ga0466711_466674 3300042615 Bacteria 3858
80 Ga0466715_098538 3300042616 Bacteria 131452
81 Ga0466715_241885 3300042616 Bacteria 16617
82 Ga0466723_010927 3300042618 Bacteria 7641
83 Ga0466723_141698 3300042618 Bacteria 266684
84 Ga0466723_150222 3300042618 Bacteria 7036
85 Ga0466726_090172 3300042619 Bacteria 28317
86 Ga0466729_186788 3300042621 Bacteria 1818
87 JGI24705J35276_12238803 3300002504 Bacteria 105587
88 Ga0068305_10000202 3300005083 Unclassified 76171
89 Ga0466695_067127 3300042595 Bacteria 4306
90 Ga0466706_049354 3300042599 Bacteria 18139
91 Ga0466706_177520 3300042599 Bacteria 18605
92 Ga0466706_214139 3300042599 Bacteria 2273
93 Ga0466707_121963 3300042601 Bacteria 17852
94 Ga0466719_325729 3300042606 Bacteria 8869
95 Ga0466719_524336 3300042606 Bacteria 382683
96 Ga0466705_008734 3300042612 Bacteria 11580
97 Ga0466705_103331 3300042612 Bacteria 16520
98 Ga0466705_356913 3300042612 Bacteria 3288
99 Ga0466733_074451 3300042659 Bacteria 9367
100 Ga0123353_10157294 3300010167 Bacteria 3621
101 Ga0466734_010610 3300042623 Bacteria 1315
102 Ga0466735_064133 3300042624 Bacteria 6460
103 Ga0466735_075487 3300042624 Bacteria 4740
104 Ga0466704_211059 3300042643 Bacteria 5284
105 Ga0466708_152802 3300042652 Bacteria 15293
106 Ga0466705_411523 3300042612 Unclassified 12832
107 Ga0466710_161636 3300042613 Bacteria 7116
108 Ga0466711_158137 3300042615 Bacteria 13654
109 Ga0466715_025789 3300042616 Bacteria 20839
110 Ga0466723_154775 3300042618 Bacteria 5858
111 Ga0466726_487075 3300042619 Bacteria 5841
112 Ga0068302_10000977 3300005071 Bacteria 9169
113 Ga0068305_10000168 3300005083 Bacteria 304006
114 Ga0068305_10000199 3300005083 Bacteria 31184
115 Ga0466696_051701 3300042596 Bacteria 27273
116 Ga0466707_134944 3300042601 Bacteria 69379
117 Ga0466707_311805 3300042601 Bacteria 94534
118 Ga0466716_375751 3300042605 Bacteria 18171
119 Ga0466716_399537 3300042605 Bacteria 33567
120 Ga0466719_406456 3300042606 Bacteria 24965
121 Ga0466705_345143 3300042612 Bacteria 11010
122 Ga0123355_10000291 3300009826 Bacteria 64274
123 Ga0466731_385872 3300042622 Bacteria 10823
124 Ga0466735_155568 3300042624 Bacteria 10836
125 Ga0466702_177812 3300042635 Bacteria 4368
126 Ga0466708_022299 3300042652 Bacteria 12225
127 Ga0466708_216009 3300042652 Bacteria 21790
128 Ga0466727_257139 3300042655 Bacteria 56896
129 Ga0466710_062518 3300042613 Bacteria 24201
130 Ga0466711_040848 3300042615 Bacteria 4432
131 Ga0466711_064092 3300042615 Bacteria 13272
132 Ga0466711_188252 3300042615 Bacteria 2070
133 Ga0466711_195401 3300042615 Bacteria 76164
134 Ga0466718_103741 3300042617 Bacteria 1825
135 Ga0466728_096721 3300042620 Bacteria 4475
136 IMNBL1DRAFT_c0000004 3300000062 Bacteria 271062
137 IMNBL1DRAFT_c0000266 3300000062 Bacteria 46407
138 Ga0068302_10003923 3300005071 Bacteria 3686
139 Ga0466690_030066 3300042590 Bacteria 3772
140 Ga0466707_165955 3300042601 Bacteria 16175
141 Ga0466716_322063 3300042605 Bacteria 4151
142 Ga0466716_531600 3300042605 Bacteria 5934
143 Ga0466721_030895 3300042608 Bacteria 26362
144 Ga0466705_152901 3300042612 Bacteria 18256
145 Ga0466705_321631 3300042612 Bacteria 270475
146 Ga0466733_018838 3300042659 Bacteria 2846
147 Ga0123356_10099014 3300010049 Bacteria 2793
148 Ga0123353_10003195 3300010167 Bacteria 20629
149 Ga0123353_10012731 3300010167 Bacteria 11994
150 Ga0466735_002449 3300042624 Bacteria 6310
151 Ga0466735_134648 3300042624 Bacteria 3320
152 Ga0466703_250320 3300042636 Bacteria 592480
153 Ga0466704_012048 3300042643 Bacteria 79416
154 Ga0466708_236624 3300042652 Bacteria 31033
155 Ga0466727_347688 3300042655 Unclassified 3534
156 Ga0466711_134125 3300042615 Bacteria 100014
157 Ga0466715_063048 3300042616 Bacteria 25995
158 Ga0466723_241706 3300042618 Unclassified 16621
159 Ga0466726_047931 3300042619 Bacteria 81147
160 Ga0466729_018474 3300042621 Bacteria 21916
161 IMNBL1DRAFT_c0000440 3300000062 Bacteria 34886
162 Ga0255576_1000001 3300026558 Bacteria 687723
163 Ga0466690_032452 3300042590 Bacteria 13137
164 Ga0466690_313401 3300042590 Bacteria 36055
165 Ga0466696_070358 3300042596 Bacteria 1347
166 Ga0466713_077401 3300042602 Bacteria 5374
167 Ga0466713_110936 3300042602 Bacteria 53952
168 Ga0466714_112063 3300042603 Bacteria 53411
169 Ga0466722_024175 3300042609 Bacteria 3737
170 Ga0466705_056405 3300042612 Bacteria 35525
171 Ga0123357_10050950 3300009784 Bacteria 5601
172 Ga0123356_10010953 3300010049 Bacteria 8857
173 Ga0123353_10160975 3300010167 Bacteria 3574
174 Ga0123353_10303892 3300010167 Bacteria 2433
175 Ga0466735_014424 3300042624 Bacteria 8132
176 Ga0466735_135516 3300042624 Bacteria 5184
177 Ga0466735_156733 3300042624 Bacteria 12015
178 Ga0466703_293627 3300042636 Bacteria 11314
179 Ga0466703_427775 3300042636 Bacteria 5767
180 Ga0466704_161941 3300042643 Unclassified 5966
181 Ga0466704_235621 3300042643 Bacteria 3839
182 Ga0466724_39605 3300042649 Bacteria 6681
183 Ga0466727_168534 3300042655 Bacteria 69590
184 Ga0466711_000452 3300042615 Bacteria 9573
185 Ga0466723_066971 3300042618 Bacteria 14746
186 Ga0466726_380593 3300042619 Bacteria 10291
187 Ga0466729_024583 3300042621 Bacteria 11953
188 2227507960 2225789004 Bacteria 65507
189 JGI24700J35501_10930822 3300002508 Bacteria 25681
190 Ga0466696_023019 3300042596 Bacteria 39682
191 Ga0466696_057770 3300042596 Bacteria 5102
192 Ga0466696_274137 3300042596 Bacteria 12935
193 Ga0466706_099491 3300042599 Bacteria 6177
194 Ga0466713_046830 3300042602 Bacteria 25753
195 Ga0466719_082398 3300042606 Bacteria 66540
196 Ga0466719_123356 3300042606 Bacteria 12323
197 Ga0466719_390852 3300042606 Bacteria 7838

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF13288 DXPR_C DXP reductoisomerase C-terminal domain 336 452 0.98
PF08436 DXP_redisom_C 1-deoxy-D-xylulose 5-phosphate reductoisomerase C-terminal domain 230 304 0.89
PF02670 DXP_reductoisom 1-deoxy-D-xylulose 5-phosphate reductoisomerase 11 64 0.87

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF08436 GO:0005515 protein binding MF
PF02670 GO:0070402 NADPH binding MF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.