Protein Family IF06482
Metagenome
Isolate
247
Members
97
Samples
216
Scaffolds
333.66
Avg Length
Representative Sequence
- ID
- 3300042606|Ga0466719_119253|Ga0466719_119253_410_1558
- Length
- 382 aa
- Sequence
- VRKSLQQQRTLSPAKKQKLQLSCLQPQRNAKNRKFLFLYRTKFAIMNLATSKKHMPNVVVIGNGSWATAQMLLLTQNLETVGWFIRDEKMIDYIRRYKRNPRYLHASKLDTDKIKMSCDINSLVCDADIIIIAVPSAFCKIILGEITCNISEKFIVSTTKGIIPDEHLTLSEYMNEQFSVPFANICIISGPCHAEEIALQRLSYLTFASKKAEAAEAIAKLYKTSYVKAVISADVYGTEYGAILKNIYAVGVGICLGLGYGDNFISVFTANAHREMKRFLNESYPSKRNTSRSSYLGDLLVTCYSNFSRNRTFGTLIGKGYSPEEAIAEMKMIAEGYYAARGIYEVNKRLNISMPIAKAVYKILYTRASAAKQMELVSEVLM
Sample Types
Isolate
12.6%
Metagenome
87.5%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
22.7%
Kalotermitidae
15.9%
Unclassified
13.6%
Culicidae
10.2%
Elmidae
9.1%
Armadillidiidae
5.7%
Termopsidae
4.5%
Rhinotermitidae
4.5%
Drosophilidae
2.3%
Passalidae
2.3%
Blattidae
2.3%
Cambaridae
2.3%
Aphididae
1.1%
Nephropidae
1.1%
Hydrophilidae
1.1%
Hodotermitidae
1.1%
Taxonomy
Archaea
0
Bacteria
238
Eukaryota
0
Viruses
1
Unclassified
8
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2864831662 | Chryseobacterium sediminis S00068 | Isolate | Elmidae |
| 2 | 2904728850 | Flavobacterium sp. xlx-214 | Isolate | |
| 3 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 4 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 5 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 6 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 7 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 8 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 9 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 10 | 8020009074 | Elizabethkingia anophelis MSU001 | Isolate | Culicidae |
| 11 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 12 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 13 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 14 | 2820768849 | Unclassified Bacteroidetes Lab288P3bin194 | Isolate | Unclassified |
| 15 | 2820774381 | Unclassified Bacteroidetes Lab288P1bin37 | Isolate | Unclassified |
| 16 | 2864923010 | Elizabethkingia anophelis S00177 | Isolate | Elmidae |
| 17 | 2820748953 | Unclassified Bacteroidetes Nt197P4bin17 | Isolate | Unclassified |
| 18 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 19 | 3300007085 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut | Metagenome | Drosophilidae |
| 20 | 3300009460 | Microbial communities of aphids from Pistacia texana in Langtry, TX, USA - Geopemphigus sp. seqcov | Metagenome | |
| 21 | 3300012837 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG | Metagenome | Armadillidiidae |
| 22 | 3300012850 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E0 MG | Metagenome | Culicidae |
| 23 | 3300012854 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG | Metagenome | Culicidae |
| 24 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 25 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 26 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 27 | 2820789850 | Unclassified Bacteroidetes Cu122P3bin3 | Isolate | Unclassified |
| 28 | 2847090942 | Elizabethkingia anophelis Ag1 | Isolate | Culicidae |
| 29 | 2864882932 | Chryseobacterium shingense S00136 | Isolate | Elmidae |
| 30 | 2864891731 | Chryseobacterium defluvii S00151 | Isolate | Elmidae |
| 31 | 2687453786 | Chryseobacterium culicis DSM 23031 | Isolate | Unclassified |
| 32 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 33 | 3300012841 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E1 MG | Metagenome | Armadillidiidae |
| 34 | 3300012847 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG | Metagenome | Armadillidiidae |
| 35 | 643348524 | Candidatus Azobacteroides pseudotrichonymphae gv. CFP2 | Isolate | Unclassified |
| 36 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 37 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 38 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 39 | 2864836148 | Arcicella rosea S00070 | Isolate | Elmidae |
| 40 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 41 | 2529292732 | Elizabethkingia anophelis R26 | Isolate | Culicidae |
| 42 | 2718218155 | Flavobacteriaceae bacterium UJ101 | Isolate | |
| 43 | 2998929858 | Bacteroidetes endosymbiont of Geopemphigus sp. GspS2-BC2016 | Isolate | Aphididae |
| 44 | 3300002464 | Anopheles gambiae gut viral communities from New Mexico State University, USA - SM1 | Metagenome | Culicidae |
| 45 | 3300007143 | Drosophila gut microbial communities from New York, USA - Drosophila putrida female 3 gut | Metagenome | Drosophilidae |
| 46 | 3300012812 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E11 MG | Metagenome | Culicidae |
| 47 | 3300012858 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG | Metagenome | Armadillidiidae |
| 48 | 2838772460 | Aquimarina sp. I32.4 | Isolate | Nephropidae |
| 49 | 2820736622 | Unclassified Bacteroidetes Th196P4bin26 | Isolate | Unclassified |
| 50 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 51 | 3300012798 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E6 MG | Metagenome | |
| 52 | 3300012814 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E6 MG | Metagenome | |
| 53 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 54 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 55 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 56 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 57 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 58 | 2864948220 | Elizabethkingia anophelis S00205 | Isolate | Elmidae |
| 59 | 2873776654 | Pedobacter sp. HDW13 | Isolate | Hydrophilidae |
| 60 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 61 | 3300012834 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG | Metagenome | |
| 62 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 63 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 64 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 65 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 66 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 67 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 68 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 69 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 70 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 71 | 8114076984 | Elizabethkingia anophelis R26 | Isolate | Culicidae |
| 72 | 2864788197 | Elizabethkingia anophelis S00027 | Isolate | Elmidae |
| 73 | 2864822740 | Chryseobacterium shigense S00064 | Isolate | Elmidae |
| 74 | 2882250448 | Bizionia sp. APA-3 | Isolate | |
| 75 | 2910959314 | Dysgonomonas sp. 511 | Isolate | Blattidae |
| 76 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 77 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 78 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 79 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 80 | 3300012829 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG | Metagenome | Armadillidiidae |
| 81 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 82 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 83 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 84 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 85 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 86 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 87 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 88 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 89 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 90 | 2820772500 | Unclassified Bacteroidetes Lab288P1bin72 | Isolate | Unclassified |
| 91 | 2921902974 | Chryseobacterium sp. cx-624 | Isolate | Cambaridae |
| 92 | 2958471994 | Flavobacterium sp. xlx-221 | Isolate | Cambaridae |
| 93 | 2820740053 | Unclassified Bacteroidetes Th196P3bin81 | Isolate | Unclassified |
| 94 | 3004677695 | Bacteroides sp. 214 | Isolate | Blattidae |
| 95 | 3300012845 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG | Metagenome | Culicidae |
| 96 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 97 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_020803 | 3300042612 | Bacteria | 2116 |
| 2 | Ga0466705_354997 | 3300042612 | Bacteria | 11138 |
| 3 | Ga0466732_123638 | 3300042656 | Bacteria | 7089 |
| 4 | Ga0466733_025888 | 3300042659 | Bacteria | 28930 |
| 5 | Ga0160444_100039 | 3300012841 | Bacteria | 198767 |
| 6 | Ga0456237_0000003 | 3300041968 | Bacteria | 82299 |
| 7 | Ga0466692_167919 | 3300042591 | Bacteria | 2540 |
| 8 | Ga0466691_176004 | 3300042593 | Bacteria | 4603 |
| 9 | Ga0466696_041797 | 3300042596 | Bacteria | 4593 |
| 10 | Ga0466703_082993 | 3300042636 | Bacteria | 10133 |
| 11 | Ga0466704_161992 | 3300042643 | Bacteria | 55801 |
| 12 | Ga0466704_170080 | 3300042643 | Bacteria | 45113 |
| 13 | Ga0466704_187057 | 3300042643 | Bacteria | 3205 |
| 14 | Ga0466704_284945 | 3300042643 | Bacteria | 11635 |
| 15 | Ga0466704_458751 | 3300042643 | Bacteria | 8656 |
| 16 | Ga0466708_093005 | 3300042652 | Bacteria | 17156 |
| 17 | Ga0466727_071596 | 3300042655 | Bacteria | 6538 |
| 18 | Ga0123353_10016860 | 3300010167 | Bacteria | 10700 |
| 19 | Ga0123353_10524581 | 3300010167 | Bacteria | 1717 |
| 20 | Ga0466711_064670 | 3300042615 | Bacteria | 2878 |
| 21 | Ga0466726_176697 | 3300042619 | Bacteria | 8659 |
| 22 | Ga0466728_358455 | 3300042620 | Bacteria | 7911 |
| 23 | Ga0466706_035751 | 3300042599 | Bacteria | 22276 |
| 24 | Ga0466714_011913 | 3300042603 | Bacteria | 9635 |
| 25 | Ga0466716_280499 | 3300042605 | Bacteria | 3139 |
| 26 | Ga0466716_436623 | 3300042605 | Bacteria | 1484 |
| 27 | Ga0466719_065159 | 3300042606 | Bacteria | 5312 |
| 28 | Ga0466722_035543 | 3300042609 | Bacteria | 116913 |
| 29 | Ga0466698_301493 | 3300042610 | Bacteria | 1842 |
| 30 | IMNBL1DRAFT_c0003058 | 3300000062 | Bacteria | 11043 |
| 31 | Meta3P_1000330 | 3300002464 | Bacteria | 26448 |
| 32 | Ga0104045_1002684 | 3300007085 | Bacteria | 9260 |
| 33 | Ga0104048_1003010 | 3300007143 | Unclassified | 4258 |
| 34 | Ga0466705_247104 | 3300042612 | Bacteria | 4076 |
| 35 | Ga0466705_307412 | 3300042612 | Bacteria | 11817 |
| 36 | Ga0466705_313639 | 3300042612 | Bacteria | 1097 |
| 37 | Ga0466705_368539 | 3300042612 | Bacteria | 6611 |
| 38 | Ga0466732_256012 | 3300042656 | Bacteria | 96394 |
| 39 | Ga0160455_100494 | 3300012837 | Bacteria | 19654 |
| 40 | Ga0466690_095436 | 3300042590 | Bacteria | 11845 |
| 41 | Ga0466690_210093 | 3300042590 | Bacteria | 5283 |
| 42 | Ga0466696_438911 | 3300042596 | Bacteria | 14933 |
| 43 | Ga0466734_032741 | 3300042623 | Bacteria | 6526 |
| 44 | Ga0466703_407258 | 3300042636 | Bacteria | 17762 |
| 45 | Ga0466709_303647 | 3300042648 | Bacteria | 5021 |
| 46 | Ga0466724_25433 | 3300042649 | Bacteria | 649431 |
| 47 | Ga0466727_129558 | 3300042655 | Unclassified | 2819 |
| 48 | Ga0466727_343646 | 3300042655 | Bacteria | 23959 |
| 49 | Ga0466710_039573 | 3300042613 | Bacteria | 4304 |
| 50 | Ga0466711_234499 | 3300042615 | Bacteria | 6630 |
| 51 | Ga0466715_042305 | 3300042616 | Bacteria | 3619 |
| 52 | Ga0466715_148878 | 3300042616 | Bacteria | 20966 |
| 53 | Ga0466723_275212 | 3300042618 | Unclassified | 5573 |
| 54 | Ga0466726_157806 | 3300042619 | Bacteria | 1195 |
| 55 | Ga0466726_408199 | 3300042619 | Bacteria | 2384 |
| 56 | Ga0466728_078118 | 3300042620 | Bacteria | 48135 |
| 57 | Ga0466728_484929 | 3300042620 | Bacteria | 2802 |
| 58 | Ga0466706_016322 | 3300042599 | Bacteria | 10637 |
| 59 | Ga0466706_143789 | 3300042599 | Bacteria | 7590 |
| 60 | Ga0466706_145083 | 3300042599 | Bacteria | 1589 |
| 61 | Ga0466713_015196 | 3300042602 | Bacteria | 51519 |
| 62 | Ga0466716_171732 | 3300042605 | Bacteria | 8434 |
| 63 | Ga0466716_207367 | 3300042605 | Bacteria | 8023 |
| 64 | Ga0466722_078029 | 3300042609 | Bacteria | 11440 |
| 65 | IMNBL1DRAFT_c0006336 | 3300000062 | Bacteria | 6486 |
| 66 | Ga0068302_10087696 | 3300005071 | Bacteria | 4044 |
| 67 | Ga0466705_165701 | 3300042612 | Bacteria | 13079 |
| 68 | Ga0466732_018550 | 3300042656 | Bacteria | 1496 |
| 69 | Ga0466733_111595 | 3300042659 | Bacteria | 3474 |
| 70 | Ga0466733_111961 | 3300042659 | Bacteria | 105531 |
| 71 | Ga0160453_100177 | 3300012814 | Bacteria | 62248 |
| 72 | Ga0160453_100300 | 3300012814 | Bacteria | 44287 |
| 73 | Ga0160467_100534 | 3300012829 | Unclassified | 35316 |
| 74 | Ga0160452_101948 | 3300012834 | Bacteria | 5017 |
| 75 | Ga0466690_228321 | 3300042590 | Bacteria | 5873 |
| 76 | Ga0466692_141318 | 3300042591 | Bacteria | 2121 |
| 77 | Ga0466691_076353 | 3300042593 | Bacteria | 10943 |
| 78 | Ga0466691_184606 | 3300042593 | Bacteria | 4553 |
| 79 | Ga0466696_112857 | 3300042596 | Bacteria | 4529 |
| 80 | Ga0466703_142800 | 3300042636 | Unclassified | 3797 |
| 81 | Ga0466704_129076 | 3300042643 | Bacteria | 3316 |
| 82 | Ga0466724_28977 | 3300042649 | Bacteria | 85636 |
| 83 | Ga0466708_210002 | 3300042652 | Bacteria | 14137 |
| 84 | Ga0466708_368937 | 3300042652 | Bacteria | 9431 |
| 85 | Ga0466725_002982 | 3300042654 | Bacteria | 58295 |
| 86 | Ga0123353_10470921 | 3300010167 | Bacteria | 1842 |
| 87 | Ga0160454_100005 | 3300012798 | Bacteria | 435562 |
| 88 | Ga0466715_136719 | 3300042616 | Bacteria | 4927 |
| 89 | Ga0466723_264066 | 3300042618 | Bacteria | 8148 |
| 90 | Ga0466723_304001 | 3300042618 | Bacteria | 3642 |
| 91 | Ga0466726_155137 | 3300042619 | Bacteria | 1423 |
| 92 | Ga0466728_279823 | 3300042620 | Bacteria | 34589 |
| 93 | Ga0466729_107623 | 3300042621 | Bacteria | 1579 |
| 94 | Ga0466701_048008 | 3300042598 | Bacteria | 204591 |
| 95 | Ga0466714_154969 | 3300042603 | Bacteria | 4612 |
| 96 | Ga0466717_030877 | 3300042604 | Bacteria | 1223 |
| 97 | Ga0466721_178363 | 3300042608 | Bacteria | 3217 |
| 98 | IMNBL1DRAFT_c0000072 | 3300000062 | Bacteria | 91151 |
| 99 | IMNBL1DRAFT_c0003089 | 3300000062 | Bacteria | 10984 |
| 100 | JGI24705J35276_12226162 | 3300002504 | Bacteria | 2818 |
| 101 | Ga0068302_10035943 | 3300005071 | Unclassified | 1266 |
| 102 | Ga0466705_354906 | 3300042612 | Bacteria | 74068 |
| 103 | Ga0160457_1001429 | 3300012858 | Bacteria | 6591 |
| 104 | Ga0265387_1003510 | 3300024582 | Bacteria | 2164 |
| 105 | Ga0466690_032191 | 3300042590 | Bacteria | 15907 |
| 106 | Ga0466690_104687 | 3300042590 | Bacteria | 15936 |
| 107 | Ga0466690_204942 | 3300042590 | Bacteria | 4733 |
| 108 | Ga0466734_027373 | 3300042623 | Bacteria | 1542 |
| 109 | Ga0466703_195275 | 3300042636 | Bacteria | 2296 |
| 110 | Ga0466708_032469 | 3300042652 | Bacteria | 7402 |
| 111 | Ga0123356_10429159 | 3300010049 | Bacteria | 1466 |
| 112 | Ga0123353_10092093 | 3300010167 | Bacteria | 4882 |
| 113 | Ga0160471_100005 | 3300012812 | Bacteria | 554359 |
| 114 | Ga0466711_228872 | 3300042615 | Bacteria | 8842 |
| 115 | Ga0466711_363285 | 3300042615 | Bacteria | 32228 |
| 116 | Ga0466715_562323 | 3300042616 | Bacteria | 11324 |
| 117 | Ga0466723_118822 | 3300042618 | Bacteria | 5912 |
| 118 | Ga0466706_023319 | 3300042599 | Bacteria | 18334 |
| 119 | Ga0466714_073026 | 3300042603 | Bacteria | 5189 |
| 120 | Ga0466716_130852 | 3300042605 | Bacteria | 16016 |
| 121 | Ga0466722_038319 | 3300042609 | Bacteria | 8924 |
| 122 | Ga0466722_184008 | 3300042609 | Bacteria | 25711 |
| 123 | 2227303007 | 2225789004 | Bacteria | 29314 |
| 124 | Ga0466697_228866 | 3300042611 | Bacteria | 1461 |
| 125 | Ga0466705_284582 | 3300042612 | Bacteria | 37665 |
| 126 | Ga0466705_302460 | 3300042612 | Bacteria | 17135 |
| 127 | Ga0160434_100238 | 3300012850 | Bacteria | 23270 |
| 128 | Ga0466696_155030 | 3300042596 | Bacteria | 8129 |
| 129 | Ga0466696_313856 | 3300042596 | Bacteria | 19455 |
| 130 | Ga0466703_004906 | 3300042636 | Bacteria | 4231 |
| 131 | Ga0123356_10272131 | 3300010049 | Bacteria | 1784 |
| 132 | Ga0123356_10418579 | 3300010049 | Bacteria | 1481 |
| 133 | Ga0466715_461393 | 3300042616 | Bacteria | 12344 |
| 134 | Ga0466723_031794 | 3300042618 | Bacteria | 14982 |
| 135 | Ga0466723_116420 | 3300042618 | Bacteria | 13144 |
| 136 | Ga0466729_170048 | 3300042621 | Bacteria | 1403 |
| 137 | Ga0466707_366782 | 3300042601 | Bacteria | 1121 |
| 138 | Ga0466716_176169 | 3300042605 | Bacteria | 2463 |
| 139 | IMNBL1DRAFT_c0007409 | 3300000062 | Bacteria | 5774 |
| 140 | IMNBL1DRAFT_c0029461 | 3300000062 | Unclassified | 2029 |
| 141 | Ga0127649_100123 | 3300009460 | Bacteria | 51721 |
| 142 | Ga0466733_194115 | 3300042659 | Bacteria | 4301 |
| 143 | Ga0160445_106486 | 3300012847 | Bacteria | 1909 |
| 144 | Ga0466692_116427 | 3300042591 | Bacteria | 133716 |
| 145 | Ga0466691_091359 | 3300042593 | Bacteria | 169365 |
| 146 | Ga0466730_052548 | 3300042625 | Bacteria | 224608 |
| 147 | Ga0466703_109112 | 3300042636 | Bacteria | 13554 |
| 148 | Ga0466704_075713 | 3300042643 | Bacteria | 36071 |
| 149 | Ga0466708_114290 | 3300042652 | Bacteria | 2071 |
| 150 | Ga0466708_341777 | 3300042652 | Bacteria | 6342 |
| 151 | Ga0466727_052006 | 3300042655 | Bacteria | 13726 |
| 152 | Ga0123356_10106989 | 3300010049 | Bacteria | 2694 |
| 153 | Ga0123353_10618011 | 3300010167 | Bacteria | 1544 |
| 154 | Ga0466715_052065 | 3300042616 | Bacteria | 25727 |
| 155 | Ga0466723_135191 | 3300042618 | Bacteria | 23983 |
| 156 | Ga0466728_196254 | 3300042620 | Bacteria | 11024 |
| 157 | Ga0466706_264164 | 3300042599 | Bacteria | 10011 |
| 158 | Ga0466719_393855 | 3300042606 | Bacteria | 1356 |
| 159 | Ga0466722_081777 | 3300042609 | Bacteria | 6147 |
| 160 | Ga0466705_333479 | 3300042612 | Bacteria | 9634 |
| 161 | Ga0160457_1000023 | 3300012858 | Bacteria | 328177 |
| 162 | Ga0466690_184827 | 3300042590 | Bacteria | 5413 |
| 163 | Ga0466690_392447 | 3300042590 | Bacteria | 51684 |
| 164 | Ga0466691_088301 | 3300042593 | Bacteria | 6391 |
| 165 | Ga0466691_092238 | 3300042593 | Bacteria | 7364 |
| 166 | Ga0466691_139200 | 3300042593 | Bacteria | 5319 |
| 167 | Ga0466696_125800 | 3300042596 | Bacteria | 19941 |
| 168 | Ga0466699_415691 | 3300042597 | Bacteria | 1505 |
| 169 | Ga0466735_140688 | 3300042624 | Bacteria | 1507 |
| 170 | Ga0466703_279126 | 3300042636 | Bacteria | 2648 |
| 171 | Ga0466709_298019 | 3300042648 | Bacteria | 16242 |
| 172 | Ga0466724_27328 | 3300042649 | Bacteria | 8062 |
| 173 | Ga0466708_028638 | 3300042652 | Bacteria | 17459 |
| 174 | Ga0466708_183984 | 3300042652 | Bacteria | 148491 |
| 175 | Ga0123356_10307093 | 3300010049 | Bacteria | 1694 |
| 176 | Ga0123356_10487086 | 3300010049 | Bacteria | 1387 |
| 177 | Ga0123353_10000053 | 3300010167 | Bacteria | 130089 |
| 178 | Ga0123353_10043937 | 3300010167 | Bacteria | 7081 |
| 179 | Ga0123353_10077811 | 3300010167 | Bacteria | 5330 |
| 180 | Ga0466712_183189 | 3300042614 | Bacteria | 1159 |
| 181 | Ga0466712_286643 | 3300042614 | Bacteria | 1626 |
| 182 | Ga0466711_060974 | 3300042615 | Bacteria | 3792 |
| 183 | Ga0466715_022900 | 3300042616 | Bacteria | 2777 |
| 184 | Ga0466716_147925 | 3300042605 | Bacteria | 1776 |
| 185 | 2227507978 | 2225789004 | Bacteria | 18685 |
| 186 | JGI24702J35022_10000464 | 3300002462 | Bacteria | 24409 |
| 187 | JGI24702J35022_10001572 | 3300002462 | Bacteria | 14168 |
| 188 | Ga0068302_10723396 | 3300005071 | Bacteria | 1384 |
| 189 | Ga0072941_1094550 | 3300005201 | Bacteria | 4466 |
| 190 | Ga0104045_1019258 | 3300007085 | Bacteria | 6848 |
| 191 | Ga0466733_212341 | 3300042659 | Bacteria | 2205 |
| 192 | Ga0160460_100068 | 3300012845 | Bacteria | 160857 |
| 193 | Ga0160448_100530 | 3300012854 | Bacteria | 13028 |
| 194 | Ga0466692_126058 | 3300042591 | Bacteria | 3837 |
| 195 | Ga0466696_112737 | 3300042596 | Bacteria | 8023 |
| 196 | Ga0466735_064485 | 3300042624 | Bacteria | 1029 |
| 197 | Ga0466703_238997 | 3300042636 | Bacteria | 1262 |
| 198 | Ga0466709_143996 | 3300042648 | Bacteria | 5710 |
| 199 | Ga0466708_245860 | 3300042652 | Unclassified | 1945 |
| 200 | Ga0466708_307594 | 3300042652 | Bacteria | 4743 |
| 201 | Ga0466708_397897 | 3300042652 | Bacteria | 54943 |
| 202 | Ga0123354_10016258 | 3300010882 | Bacteria | 11658 |
| 203 | Ga0466710_409629 | 3300042613 | Bacteria | 1309 |
| 204 | Ga0466711_452131 | 3300042615 | Bacteria | 22380 |
| 205 | Ga0466715_419506 | 3300042616 | Bacteria | 2720 |
| 206 | Ga0466723_271752 | 3300042618 | Bacteria | 1986 |
| 207 | Ga0466728_027424 | 3300042620 | Bacteria | 16928 |
| 208 | Ga0466728_054337 | 3300042620 | Viruses | 4954 |
| 209 | Ga0466729_105197 | 3300042621 | Bacteria | 5358 |
| 210 | Ga0466706_025174 | 3300042599 | Bacteria | 118676 |
| 211 | Ga0466719_119253 | 3300042606 | Bacteria | 3682 |
| 212 | Ga0466719_495200 | 3300042606 | Bacteria | 1517 |
| 213 | Ga0466722_097757 | 3300042609 | Bacteria | 5004 |
| 214 | Ga0466722_159367 | 3300042609 | Bacteria | 5918 |
| 215 | Ga0068305_10002946 | 3300005083 | Bacteria | 63588 |
| 216 | Ga0072941_1578842 | 3300005201 | Bacteria | 1118 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF07479 | NAD_Gly3P_dh_C | NAD-dependent glycerol-3-phosphate dehydrogenase C-terminus | 234 | 372 | 0.97 |
| PF01210 | NAD_Gly3P_dh_N | NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus | 58 | 214 | 0.96 |
| PF20618 | GPD_NAD_C_bact | Bacterial GPD, NAD-dependent C-terminal | 294 | 360 | 0.91 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.