Protein Family IF06451
Metagenome
Isolate
275
Members
181
Samples
151
Scaffolds
366.87
Avg Length
Representative Sequence
- ID
- 3300042606|Ga0466719_032484|Ga0466719_032484_11970_13211
- Length
- 413 aa
- Sequence
- MNGTFLYPEEKNMVKMSLEHIRKVYPNQVIAAVPDYNLEIDDGEFTVFIGPSGSGKSTVLRMIAGLEDITSGEFKIGDKVMNDVEPKNRDIAMVFQNYALYPHMTVRDNMAFGLKLRKMNKEEIDTRVQKAAEMLSLEEFLDRKPANLSGGQRQRVALGRAIVRDAQVMLLDEPLSNLDAKLRVEMRSTISKLHQQLKNNMIYVTHDQIEAMTMADRIVLIDHGVIQQDGSPEELYNKPGNKFVAGFMGSPSMNLINVDVKGDKIITKDGKVSLKLPKSKSKLLKDKGYDGKEVVFGIRPEDIHTEPITKETYPGDTVNVKLDLVEPLGAETMLYFQLDNNNFVARVGSRDTSKTGENTELTFQLPNAHFFDPETEIVITNDETTYKSPTRQESDLANSKGTSLEGTKNSGKY
Sample Types
Isolate
45.1%
Metagenome
54.9%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
36.4%
Termitidae
12.7%
Apidae
10.4%
Muscidae
7.5%
Kalotermitidae
6.4%
Formicidae
4.0%
Tenebrionidae
2.3%
Blattidae
2.3%
Culicidae
1.7%
Armadillidiidae
1.7%
Calliphoridae
1.7%
Passalidae
1.7%
Plutellidae
1.2%
Rhinotermitidae
1.2%
Cerambycidae
1.2%
Termopsidae
1.2%
Anthomyiidae
0.6%
Ixodidae
0.6%
Acrididae
0.6%
Coreidae
0.6%
Hydrophilidae
0.6%
Tephritidae
0.6%
Elmidae
0.6%
Pyralidae
0.6%
Noctuidae
0.6%
Scarabaeidae
0.6%
Hodotermitidae
0.6%
Taxonomy
Archaea
0
Bacteria
252
Eukaryota
0
Viruses
0
Unclassified
23
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820803007 | Unclassified Actinobacteria Th196P3bin61 | Isolate | Unclassified |
| 2 | 2856068565 | Cronobacter sakazakii MOD1-Md35s | Isolate | Muscidae |
| 3 | 2896925746 | Vibrio nigripulchritudo SFn27 | Isolate | Unclassified |
| 4 | 2609459925 | Vibrio nigripulchritudo SO65 | Isolate | Unclassified |
| 5 | 2627853677 | Vibrio nigripulchritudo FTn2 | Isolate | Unclassified |
| 6 | 2808606957 | Bifidobacterium sp. ESL0447 | Isolate | Unclassified |
| 7 | 8110341875 | Bifidobacterium polysaccharolyticum W8117 | Isolate | Apidae |
| 8 | 8022116796 | Vibrio sp. T3Y01 | Isolate | Unclassified |
| 9 | 8051461712 | Vibrio vulnificus Vv002 | Isolate | |
| 10 | 8060845732 | Vibrio vulnificus Vv006 | Isolate | |
| 11 | 8064531044 | Terrisporobacter mayombei DSM 6539 | Isolate | Unclassified |
| 12 | 2967924226 | Cronobacter malonaticus MOD1-Md25g | Isolate | Muscidae |
| 13 | 2970322301 | Cronobacter sakazakii MOD1-Md33g | Isolate | Muscidae |
| 14 | 2989793055 | Vibrio atypicus DSM 25292 | Isolate | Unclassified |
| 15 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 16 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 17 | 3300007188 | Ant gut microbial communities from Cephalotes rohweri, Arizona, USA | Metagenome | Formicidae |
| 18 | 3300012835 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG | Metagenome | Culicidae |
| 19 | 3300012849 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG | Metagenome | Culicidae |
| 20 | 3300035363 | Gut microbial communities from Plutella xylostella in Fujian, Fuzhou, China - pupa gut | Metagenome | Plutellidae |
| 21 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 22 | 2820845766 | Unclassified Actinobacteria Lab288P3bin96 | Isolate | Unclassified |
| 23 | 2820922474 | Unclassified Actinobacteria Emb289P3bin154 | Isolate | Unclassified |
| 24 | 2820926697 | Unclassified Actinobacteria Emb289P3bin125 | Isolate | Unclassified |
| 25 | 2865982043 | Bifidobacterium aemilianum XV10 | Isolate | Apidae |
| 26 | 2921816052 | Cronobacter sakazakii MOD1-Anth48g | Isolate | Anthomyiidae |
| 27 | 2937427229 | Cronobacter malonaticus MOD1-Md99g | Isolate | Muscidae |
| 28 | 2505679068 | Isoptericola variabilis 225 | Isolate | Unclassified |
| 29 | 2513237174 | Bifidobacterium asteroides ATCC 25910 | Isolate | Apidae |
| 30 | 2551306516 | Enterobacter hormaechei YT3 | Isolate | Tenebrionidae |
| 31 | 2627854002 | Vibrio nigripulchritudo ENn2 | Isolate | Unclassified |
| 32 | 2645727657 | Bifidobacterium actinocoloniiforme DSM 22766 | Isolate | Unclassified |
| 33 | 2711768158 | Vibrio coralliilyticus S2043 | Isolate | Unclassified |
| 34 | 2816332503 | Tritonibacter mobilis S1611 | Isolate | Unclassified |
| 35 | 2820492969 | Unclassified Firmicutes Lab288P1bin6 | Isolate | Unclassified |
| 36 | 2820516196 | Unclassified Firmicutes Lab288P1bin3 | Isolate | Unclassified |
| 37 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 38 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 39 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 40 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 41 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 42 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 43 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 44 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 45 | 2862075925 | Corynebacterium lactis S064 | Isolate | Ixodidae |
| 46 | 2865983822 | Bifidobacterium xylocopae XV2 | Isolate | Apidae |
| 47 | 2921842437 | Cronobacter sakazakii MOD1-Lc10s | Isolate | Calliphoridae |
| 48 | 2957730672 | Cronobacter sakazakii MOD1-Md70g | Isolate | Muscidae |
| 49 | 2035265001 | Acrididae gut microbial communities from Texas A and M University, USA - Sample 321 | Metagenome | Acrididae |
| 50 | 2511231129 | Vibrio sp. EJY3 | Isolate | Unclassified |
| 51 | 2519899775 | Bifidobacterium asteroides PRL2011 | Isolate | Apidae |
| 52 | 2565956518 | Vibrio pacinii DSM 19139 | Isolate | Unclassified |
| 53 | 2597490239 | Bifidobacterium bohemicum DSM 22767 | Isolate | Unclassified |
| 54 | 2600255074 | Vibrio proteolyticus NBRC 13287 | Isolate | Unclassified |
| 55 | 2663763384 | Bifidobacterium bombi DSM 19703 | Isolate | Apidae |
| 56 | 2681812870 | Oerskovia enterophila DFA-19 | Isolate | Unclassified |
| 57 | 2711768164 | Tritonibacter mobilis S1942 | Isolate | Unclassified |
| 58 | 2816332545 | Tritonibacter mobilis S1923 | Isolate | Unclassified |
| 59 | 2820211246 | Unclassified Kiritimatiellaeota Nt197P3bin96 | Isolate | Unclassified |
| 60 | 2820348946 | Unclassified Firmicutes Nt197P3bin47 | Isolate | Unclassified |
| 61 | 8110340172 | Bifidobacterium choladohabitans B14384H11 | Isolate | Apidae |
| 62 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 63 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 64 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 65 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 66 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 67 | 8022345672 | Vibrio sp. 070316B | Isolate | Unclassified |
| 68 | 8067987626 | Agromyces larvae CFWR-12 | Isolate | Unclassified |
| 69 | 8078130113 | Caballeronia sp. INDeC2 | Isolate | Coreidae |
| 70 | 2967915117 | Cronobacter sakazakii MOD1-Lc10g | Isolate | Calliphoridae |
| 71 | 3300007142 | Ant gut microbial communities from Cephalotes grandinosus, Brazil | Metagenome | Formicidae |
| 72 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 73 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 74 | 2822856742 | Enterobacter cancerogenus CR-Eb1 | Isolate | Unclassified |
| 75 | 2874880541 | Enterobacter hormaechei E3442 | Isolate | Unclassified |
| 76 | 2964846109 | Cronobacter sakazakii MOD1-Md5g | Isolate | Muscidae |
| 77 | 2964859436 | Cronobacter sakazakii MOD1-Md40g | Isolate | Muscidae |
| 78 | 2873595552 | Erysipelothrix sp. HDW6C | Isolate | Hydrophilidae |
| 79 | 2225789003 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) | Metagenome | Passalidae |
| 80 | 2547132185 | Enterobacter cancerogenus YZ1 | Isolate | Tenebrionidae |
| 81 | 2684622918 | Bifidobacterium asteroides Bi_198 | Isolate | Unclassified |
| 82 | 2791355471 | Vibrio bivalvicida 605 | Isolate | Unclassified |
| 83 | 2820267566 | Unclassified Firmicutes Th196P3bin33 | Isolate | Unclassified |
| 84 | 8116627632 | Vibrio penaeicida NBRC 15640 | Isolate | Unclassified |
| 85 | 3300056856 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) | Metagenome | Tenebrionidae |
| 86 | 8018312681 | Enterobacter sp. OLF | Isolate | Tephritidae |
| 87 | 8024981139 | Bifidobacterium asteroides ESL0170 | Isolate | Apidae |
| 88 | 8024984606 | Bifidobacterium asteroides ESL0199 | Isolate | Apidae |
| 89 | 3000861951 | Budvicia diplopodorum D9 | Isolate | |
| 90 | 3004364956 | Cronobacter sakazakii MOD1-Md5s | Isolate | Muscidae |
| 91 | 3006225627 | Vibrio sp. Hep-1b-8 | Isolate | Unclassified |
| 92 | 3006242587 | Vibrio sp. RE86 | Isolate | Unclassified |
| 93 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 94 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 95 | 3300007095 | Ant gut microbial communities from Cephalotes minutus, Brazil | Metagenome | Formicidae |
| 96 | 3300012841 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E1 MG | Metagenome | Armadillidiidae |
| 97 | 3300012852 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG | Metagenome | |
| 98 | 3300035364 | Gut microbial communities from Plutella xylostella in Fujian, Fuzhou, China - adult gut | Metagenome | Plutellidae |
| 99 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 100 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 101 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 102 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 103 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 104 | 2820867525 | Unclassified Actinobacteria Lab288P3bin128 | Isolate | Unclassified |
| 105 | 2833053935 | Buttiauxella sp. 3AFRM03 | Isolate | Cerambycidae |
| 106 | 2864816158 | Priestia aryabhattai S00060 | Isolate | Elmidae |
| 107 | 2879643867 | Bifidobacterium sp. wkB344 | Isolate | Apidae |
| 108 | 2884351759 | Cellulosimicrobium sp. BI34T | Isolate | Pyralidae |
| 109 | 2940270707 | Lachnoclostridium sp. PF1-13 | Isolate | Blattidae |
| 110 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 111 | 2551306531 | Enterobacter hormaechei YT2 | Isolate | Tenebrionidae |
| 112 | 2648501820 | Vibrio nigripulchritudo BLFn1 | Isolate | Unclassified |
| 113 | 2684622920 | Bifidobacterium asteroides Bi_200 | Isolate | Unclassified |
| 114 | 2802429577 | Bifidobacterium indicum DSM 20214 | Isolate | Unclassified |
| 115 | 2820329821 | Unclassified Firmicutes Nt197P3bin77 | Isolate | Unclassified |
| 116 | 2970335472 | Cronobacter muytjensii MOD1-Md1s | Isolate | Muscidae |
| 117 | 2977727922 | Cronobacter sakazakii MOD1-Md33s | Isolate | Muscidae |
| 118 | 3300012806 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E1 MG | Metagenome | |
| 119 | 3300012812 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E11 MG | Metagenome | Culicidae |
| 120 | 3300012858 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG | Metagenome | Armadillidiidae |
| 121 | 2876358570 | Cronobacter sakazakii MOD1-Ls15g | Isolate | Calliphoridae |
| 122 | 2940273867 | Lachnoclostridium sp. PH1-16 | Isolate | Blattidae |
| 123 | 2568526170 | Bifidobacterium sp. A11 | Isolate | Apidae |
| 124 | 2600255079 | Bifidobacterium bombi DSM 19703 | Isolate | Apidae |
| 125 | 2684622919 | Bifidobacterium asteroides Bi_199 | Isolate | Unclassified |
| 126 | 2820504582 | Unclassified Firmicutes Lab288P1bin5 | Isolate | Unclassified |
| 127 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 128 | 8024986378 | Bifidobacterium asteroides ESL0198 | Isolate | Apidae |
| 129 | 8032009961 | Bifidobacterium indicum ESL0197 | Isolate | Apidae |
| 130 | 3300002501 | Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 | Metagenome | Termitidae |
| 131 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 132 | 3300012814 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E6 MG | Metagenome | |
| 133 | 3300030930 | Ant gut bacterial community from Pseudomyrmex nigropilosus larvae, the Area de Conservacion Guanacaste, Costa Rica - colony BER0554 | Metagenome | Formicidae |
| 134 | 3300003097 | Cutworm gut microbial communities from Hangzhou, China | Metagenome | Noctuidae |
| 135 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 136 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 137 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 138 | 2820901319 | Unclassified Actinobacteria Emb289P4bin58 | Isolate | Unclassified |
| 139 | 2884613238 | Agromyces intestinalis KACC 19306 | Isolate | Scarabaeidae |
| 140 | 2912636047 | Vibrio crassostreae 9CS106 | Isolate | Unclassified |
| 141 | 2940264388 | Lachnospiraceae bacterium PFB1-17 | Isolate | Blattidae |
| 142 | 2940267548 | Lachnospiraceae bacterium PFB1-22 | Isolate | Blattidae |
| 143 | 2065487013 | Fungus-growing termite worker microbial communities from South Africa - Oerleman's Farm | Metagenome | |
| 144 | 2504756063 | Isoptericola variabilis J5 | Isolate | Unclassified |
| 145 | 2597490194 | Bifidobacterium coryneforme LMG 18911 | Isolate | Apidae |
| 146 | 2609459958 | Vibrio nigripulchritudo Wn13 | Isolate | Unclassified |
| 147 | 2630968716 | Vibrio nigripulchritudo AM115 | Isolate | Unclassified |
| 148 | 2636415542 | Vibrio nigripulchritudo SFn135 | Isolate | Unclassified |
| 149 | 2671180601 | Bifidobacterium asteroides DSM 20089 | Isolate | Unclassified |
| 150 | 2820546020 | Unclassified Firmicutes Lab288P1bin102 | Isolate | Unclassified |
| 151 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 152 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 153 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 154 | 2977691992 | Cronobacter malonaticus MOD1-Md27g | Isolate | Muscidae |
| 155 | 2977745872 | Cronobacter sakazakii MOD1-Md1g | Isolate | Muscidae |
| 156 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 157 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 158 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 159 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 160 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 161 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 162 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 163 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 164 | 2820894511 | Unclassified Actinobacteria Lab288P1bin103 | Isolate | Unclassified |
| 165 | 2876334352 | Cronobacter sakazakii MOD1-Md6g | Isolate | Muscidae |
| 166 | 2883361506 | Luteimicrobium xylanilyticum HY-24 | Isolate | Cerambycidae |
| 167 | 2648501158 | Vibrio hepatarius DSM 19134 | Isolate | Unclassified |
| 168 | 2660238275 | Bifidobacterium indicum DSM 20214 | Isolate | Unclassified |
| 169 | 2684622916 | Bifidobacterium asteroides Bi_170 | Isolate | Unclassified |
| 170 | 2684622917 | Bifidobacterium coryneforme Bi_197 | Isolate | Unclassified |
| 171 | 2693429521 | Bifidobacterium coryneforme DSM 20216 | Isolate | Unclassified |
| 172 | 2718218026 | Phaeobacter porticola P97 | Isolate | Unclassified |
| 173 | 2788500098 | Bombiscardovia coagulans DSM 22924 | Isolate | Apidae |
| 174 | 2820600392 | Unclassified Firmicutes Emb289P1bin52 | Isolate | Unclassified |
| 175 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 176 | 8024982947 | Bifidobacterium asteroides ESL0200 | Isolate | Apidae |
| 177 | 8051551332 | Vibrio vulnificus Vv003 | Isolate | |
| 178 | 3300002932 | Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 | Metagenome | Formicidae |
| 179 | 3300005721 | Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 | Metagenome | Apidae |
| 180 | 3300007068 | Ant gut microbial communities from Cephalotes simillimus, Peru | Metagenome | Formicidae |
| 181 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0247290_00520 | 3300035364 | Unclassified | 6823 |
| 2 | Ga0466691_107525 | 3300042593 | Bacteria | 3198 |
| 3 | FGTW_contig30811 | 2065487013 | Unclassified | 9306 |
| 4 | IMNBL1DRAFT_c0000256 | 3300000062 | Bacteria | 47115 |
| 5 | JGI24702J35022_10000959 | 3300002462 | Bacteria | 18003 |
| 6 | Ga0103264_1000211 | 3300007188 | Bacteria | 33223 |
| 7 | Ga0123355_10000894 | 3300009826 | Bacteria | 41319 |
| 8 | Ga0123355_10234973 | 3300009826 | Bacteria | 2610 |
| 9 | Ga0123355_10273608 | 3300009826 | Bacteria | 2342 |
| 10 | Ga0123356_10001553 | 3300010049 | Bacteria | 25298 |
| 11 | Ga0123356_10002234 | 3300010049 | Bacteria | 20856 |
| 12 | Ga0123356_10120645 | 3300010049 | Bacteria | 2549 |
| 13 | Ga0466709_337151 | 3300042648 | Bacteria | 14763 |
| 14 | Ga0466725_373947 | 3300042654 | Bacteria | 3633 |
| 15 | Ga0466725_392848 | 3300042654 | Bacteria | 1449 |
| 16 | Ga0466700_164653 | 3300042600 | Bacteria | 2144 |
| 17 | Ga0466733_202421 | 3300042659 | Bacteria | 16584 |
| 18 | Ga0160457_1000020 | 3300012858 | Bacteria | 357225 |
| 19 | GhopperDRAF_NODE_303541_len_4756_cov_7_287216 | 2035265001 | Unclassified | 4786 |
| 20 | 2227477118 | 2225789004 | Bacteria | 4600 |
| 21 | Ga0068305_10001757 | 3300005083 | Unclassified | 35476 |
| 22 | Ga0102737_1001192 | 3300007142 | Bacteria | 7517 |
| 23 | Ga0466711_088734 | 3300042615 | Bacteria | 1655 |
| 24 | Ga0466715_091559 | 3300042616 | Bacteria | 14413 |
| 25 | Ga0466715_205939 | 3300042616 | Bacteria | 12555 |
| 26 | Ga0123355_10002644 | 3300009826 | Bacteria | 25433 |
| 27 | Ga0123356_10010394 | 3300010049 | Bacteria | 9135 |
| 28 | Ga0123353_10092479 | 3300010167 | Bacteria | 4873 |
| 29 | Ga0123353_10242621 | 3300010167 | Bacteria | 2798 |
| 30 | Ga0466704_020679 | 3300042643 | Bacteria | 7397 |
| 31 | Ga0466709_089450 | 3300042648 | Bacteria | 55766 |
| 32 | Ga0466725_147725 | 3300042654 | Bacteria | 2210 |
| 33 | Ga0466707_405810 | 3300042601 | Bacteria | 3589 |
| 34 | Ga0466719_566996 | 3300042606 | Bacteria | 16389 |
| 35 | Ga0160446_100060 | 3300012835 | Bacteria | 113052 |
| 36 | Ga0160444_100626 | 3300012841 | Bacteria | 12263 |
| 37 | Ga0316159_10487 | 3300030930 | Bacteria | 9914 |
| 38 | Ga0466692_101103 | 3300042591 | Bacteria | 19375 |
| 39 | 2227035913 | 2225789003 | Unclassified | 20753 |
| 40 | 2227106106 | 2225789004 | Bacteria | 1767 |
| 41 | 2227158575 | 2225789004 | Unclassified | 8405 |
| 42 | 2227549632 | 2225789004 | Unclassified | 15084 |
| 43 | JGI24703J35330_11634644 | 3300002501 | Bacteria | 1512 |
| 44 | Ga0103265_1009630 | 3300007068 | Bacteria | 1266 |
| 45 | Ga0102739_1000230 | 3300007095 | Bacteria | 13826 |
| 46 | Ga0466715_610857 | 3300042616 | Bacteria | 1632 |
| 47 | Ga0123353_10076024 | 3300010167 | Bacteria | 5397 |
| 48 | Ga0123353_10197363 | 3300010167 | Bacteria | 3171 |
| 49 | Ga0123353_10213246 | 3300010167 | Bacteria | 3027 |
| 50 | Ga0123353_10217169 | 3300010167 | Bacteria | 2994 |
| 51 | Ga0123353_10495380 | 3300010167 | Unclassified | 1782 |
| 52 | Ga0466709_299616 | 3300042648 | Bacteria | 2633 |
| 53 | Ga0466701_048255 | 3300042598 | Bacteria | 2730 |
| 54 | Ga0466713_080621 | 3300042602 | Bacteria | 3151 |
| 55 | Ga0466719_123098 | 3300042606 | Bacteria | 142874 |
| 56 | Ga0466733_114175 | 3300042659 | Bacteria | 4566 |
| 57 | Ga0160447_104692 | 3300012849 | Bacteria | 3984 |
| 58 | JGI24702J35022_10045690 | 3300002462 | Bacteria | 2333 |
| 59 | JGI24699J35502_11126186 | 3300002509 | Unclassified | 3918 |
| 60 | Ga0466711_442512 | 3300042615 | Bacteria | 6261 |
| 61 | Ga0466715_367373 | 3300042616 | Bacteria | 75621 |
| 62 | Ga0466723_136013 | 3300042618 | Bacteria | 2757 |
| 63 | Ga0466723_335811 | 3300042618 | Bacteria | 16701 |
| 64 | Ga0466726_231822 | 3300042619 | Bacteria | 1613 |
| 65 | Ga0466729_127392 | 3300042621 | Bacteria | 7865 |
| 66 | Ga0123355_10002222 | 3300009826 | Bacteria | 27410 |
| 67 | Ga0123355_10071763 | 3300009826 | Bacteria | 5557 |
| 68 | Ga0123355_10257159 | 3300009826 | Bacteria | 2448 |
| 69 | Ga0123356_10000177 | 3300010049 | Bacteria | 72517 |
| 70 | Ga0123356_10006703 | 3300010049 | Bacteria | 11602 |
| 71 | Ga0123356_10075474 | 3300010049 | Bacteria | 3175 |
| 72 | Ga0123353_10010357 | 3300010167 | Bacteria | 12987 |
| 73 | Ga0123353_10349597 | 3300010167 | Bacteria | 2228 |
| 74 | Ga0466704_370638 | 3300042643 | Unclassified | 1616 |
| 75 | Ga0466724_21146 | 3300042649 | Bacteria | 1418 |
| 76 | Ga0466706_151369 | 3300042599 | Unclassified | 13494 |
| 77 | Ga0466707_004690 | 3300042601 | Bacteria | 5205 |
| 78 | Ga0466713_005920 | 3300042602 | Bacteria | 33790 |
| 79 | Ga0466713_057069 | 3300042602 | Bacteria | 6150 |
| 80 | Ga0466714_063398 | 3300042603 | Bacteria | 21454 |
| 81 | Ga0466719_270167 | 3300042606 | Bacteria | 4291 |
| 82 | Ga0562375_1323 | 3300056856 | Bacteria | 34538 |
| 83 | Ga0247289_0014 | 3300035363 | Unclassified | 66947 |
| 84 | Ga0247290_00021 | 3300035364 | Bacteria | 63133 |
| 85 | Ga0466694_215038 | 3300042594 | Bacteria | 5445 |
| 86 | FGTW_contig30472 | 2065487013 | Bacteria | 25299 |
| 87 | Ga0074278_142786 | 3300005721 | Unclassified | 4187 |
| 88 | Ga0123356_10004734 | 3300010049 | Bacteria | 14020 |
| 89 | Ga0123356_10459551 | 3300010049 | Bacteria | 1423 |
| 90 | Ga0123353_10098315 | 3300010167 | Unclassified | 4717 |
| 91 | Ga0123353_10242360 | 3300010167 | Bacteria | 2800 |
| 92 | Ga0123353_10434823 | 3300010167 | Bacteria | 1938 |
| 93 | Ga0160442_100235 | 3300012806 | Bacteria | 40404 |
| 94 | Ga0466731_019350 | 3300042622 | Bacteria | 5245 |
| 95 | Ga0466730_005589 | 3300042625 | Bacteria | 36459 |
| 96 | Ga0466727_198670 | 3300042655 | Bacteria | 2291 |
| 97 | Ga0466706_237546 | 3300042599 | Bacteria | 99093 |
| 98 | Ga0466714_168329 | 3300042603 | Bacteria | 5120 |
| 99 | Ga0466705_249163 | 3300042612 | Unclassified | 7171 |
| 100 | Ga0160453_101023 | 3300012814 | Bacteria | 12473 |
| 101 | Ga0160433_101567 | 3300012846 | Unclassified | 6063 |
| 102 | IMNBL1DRAFT_c0000019 | 3300000062 | Bacteria | 170255 |
| 103 | JGI24705J35276_12216357 | 3300002504 | Bacteria | 2043 |
| 104 | CVPL010W_10009460 | 3300002931 | Bacteria | 9754 |
| 105 | Ga0466715_414478 | 3300042616 | Bacteria | 7125 |
| 106 | Ga0466723_362351 | 3300042618 | Bacteria | 36768 |
| 107 | Ga0123353_10051465 | 3300010167 | Bacteria | 6572 |
| 108 | Ga0466703_410610 | 3300042636 | Bacteria | 14920 |
| 109 | Ga0466725_095570 | 3300042654 | Bacteria | 3066 |
| 110 | Ga0466725_447475 | 3300042654 | Unclassified | 7112 |
| 111 | Ga0466719_269290 | 3300042606 | Bacteria | 2749 |
| 112 | Ga0466697_212831 | 3300042611 | Bacteria | 1170 |
| 113 | Ga0316159_10577 | 3300030930 | Unclassified | 5508 |
| 114 | Ga0466657_365540 | 3300042582 | Bacteria | 3582 |
| 115 | Ga0466692_204818 | 3300042591 | Bacteria | 4547 |
| 116 | Ga0466696_098568 | 3300042596 | Bacteria | 10026 |
| 117 | Ga0466696_191503 | 3300042596 | Bacteria | 28288 |
| 118 | IMNBL1DRAFT_c0000146 | 3300000062 | Bacteria | 63343 |
| 119 | CVPL010L_1000033 | 3300002932 | Unclassified | 91433 |
| 120 | Ga0123356_10008126 | 3300010049 | Bacteria | 10452 |
| 121 | Ga0123356_10452468 | 3300010049 | Bacteria | 1432 |
| 122 | Ga0123356_10760961 | 3300010049 | Bacteria | 1139 |
| 123 | Ga0123353_10038242 | 3300010167 | Unclassified | 7540 |
| 124 | Ga0123353_10120372 | 3300010167 | Bacteria | 4221 |
| 125 | Ga0123353_10265853 | 3300010167 | Bacteria | 2646 |
| 126 | Ga0466734_151724 | 3300042623 | Bacteria | 1463 |
| 127 | Ga0466704_593648 | 3300042643 | Bacteria | 44691 |
| 128 | Ga0466708_027553 | 3300042652 | Bacteria | 4380 |
| 129 | Ga0466727_296962 | 3300042655 | Bacteria | 1577 |
| 130 | Ga0466706_049267 | 3300042599 | Bacteria | 12653 |
| 131 | Ga0466706_085096 | 3300042599 | Bacteria | 1705 |
| 132 | Ga0466719_032484 | 3300042606 | Bacteria | 26409 |
| 133 | Ga0466697_149980 | 3300042611 | Bacteria | 1318 |
| 134 | Ga0160430_110154 | 3300012852 | Bacteria | 1642 |
| 135 | Ga0247290_00754 | 3300035364 | Unclassified | 4974 |
| 136 | Ga0466693_243721 | 3300042592 | Bacteria | 130981 |
| 137 | Ga0466696_417523 | 3300042596 | Bacteria | 2471 |
| 138 | AustNasuHG_c1013114 | 3300000089 | Bacteria | 2848 |
| 139 | JGI24699J35502_11133172 | 3300002509 | Bacteria | 9064 |
| 140 | Ga0052191_101350 | 3300003097 | Bacteria | 1145 |
| 141 | Ga0466705_509054 | 3300042612 | Bacteria | 1783 |
| 142 | Ga0466723_102398 | 3300042618 | Bacteria | 4162 |
| 143 | Ga0123355_10000622 | 3300009826 | Bacteria | 47966 |
| 144 | Ga0123355_10318774 | 3300009826 | Unclassified | 2097 |
| 145 | Ga0123356_10182865 | 3300010049 | Bacteria | 2120 |
| 146 | Ga0123354_10334371 | 3300010882 | Bacteria | 1376 |
| 147 | Ga0160471_103610 | 3300012812 | Bacteria | 2298 |
| 148 | Ga0466729_255045 | 3300042621 | Bacteria | 3644 |
| 149 | Ga0466724_29324 | 3300042649 | Unclassified | 3618 |
| 150 | Ga0466707_422929 | 3300042601 | Bacteria | 6182 |
| 151 | Ga0466713_151488 | 3300042602 | Bacteria | 34283 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.