Protein Family IF06445
Metagenome
Isolate
171
Members
52
Samples
160
Scaffolds
164.86
Avg Length
Representative Sequence
- ID
- 3300042606|Ga0466719_021770|Ga0466719_021770_3408_3989
- Length
- 193 aa
- Sequence
- MRANIREKFRFYKFCMDKNPIFALMIRIGLLSDTHGWWDDKYVKYFGTCDEIWHAGDIGSETLARDLADIKPLRAVYGNIDGYPLRRQFPMTAQFKVEDIKVMMTHIGGYPGRYDPSVRAELYAAKPQLFISGHSHILKVMFDKNLRCLHINPGAAGISGFQQVRTLVRFVIDGSEIKELEIIELGNRNERGI
Sample Types
Isolate
6.4%
Metagenome
93.6%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
27.5%
Termitidae
27.5%
Blattidae
15.7%
Unclassified
9.8%
Termopsidae
7.8%
Rhinotermitidae
5.9%
Armadillidiidae
2.0%
Hodotermitidae
2.0%
Passalidae
2.0%
Taxonomy
Archaea
0
Bacteria
165
Eukaryota
0
Viruses
0
Unclassified
6
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2940253009 | Dysgonomonas sp. PF1-23 | Isolate | Blattidae |
| 2 | 2940257232 | Dysgonomonas sp. PFB1-18 | Isolate | Blattidae |
| 3 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 4 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 5 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 6 | 2940202316 | Parabacteroides sp. PF5-9 | Isolate | Blattidae |
| 7 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 8 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 9 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 10 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 11 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 12 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 13 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 14 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 15 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 16 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 17 | 2695420314 | Dysgonomonas sp. BGC7 | Isolate | Unclassified |
| 18 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 19 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 20 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 21 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 22 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 23 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 24 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 25 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 26 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 27 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 28 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 29 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 30 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 31 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 32 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 33 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 34 | 2940248789 | Dysgonomonas sp. PF1-16 | Isolate | Blattidae |
| 35 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 36 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 37 | 2830041218 | Bacteroides reticulotermitis DSM 105720 | Isolate | Unclassified |
| 38 | 2940244548 | Dysgonomonas sp. PF1-14 | Isolate | Blattidae |
| 39 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 40 | 8100166142 | Dysgonomonas sp. GY75 | Isolate | Rhinotermitidae |
| 41 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 42 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 43 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 44 | 2940195863 | Parabacteroides sp. PF5-6 | Isolate | Blattidae |
| 45 | 2940209341 | Parabacteroides sp. PFB2-10 | Isolate | Blattidae |
| 46 | 3004667792 | Bacteroides sp. 519 | Isolate | Blattidae |
| 47 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 48 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 49 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 50 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 51 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 52 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466733_012698 | 3300042659 | Bacteria | 1949 |
| 2 | Ga0265387_1075153 | 3300024582 | Bacteria | 659 |
| 3 | Ga0466690_273522 | 3300042590 | Bacteria | 2812 |
| 4 | Ga0466691_094124 | 3300042593 | Bacteria | 8010 |
| 5 | Ga0466696_008900 | 3300042596 | Bacteria | 14230 |
| 6 | Ga0466696_206637 | 3300042596 | Bacteria | 2737 |
| 7 | Ga0466710_231396 | 3300042613 | Bacteria | 15584 |
| 8 | Ga0466726_177316 | 3300042619 | Bacteria | 2962 |
| 9 | Ga0466726_225768 | 3300042619 | Bacteria | 1060 |
| 10 | Ga0466726_253165 | 3300042619 | Bacteria | 3070 |
| 11 | Ga0466726_419298 | 3300042619 | Bacteria | 1550 |
| 12 | Ga0466728_396980 | 3300042620 | Bacteria | 8198 |
| 13 | IMNBL1DRAFT_c0052267 | 3300000062 | Bacteria | 1281 |
| 14 | Ga0466706_133883 | 3300042599 | Bacteria | 39086 |
| 15 | Ga0466713_085543 | 3300042602 | Bacteria | 51640 |
| 16 | Ga0466713_141379 | 3300042602 | Bacteria | 226907 |
| 17 | Ga0466719_021770 | 3300042606 | Bacteria | 8117 |
| 18 | Ga0466703_193733 | 3300042636 | Bacteria | 3232 |
| 19 | Ga0466704_243231 | 3300042643 | Bacteria | 4173 |
| 20 | Ga0466708_043101 | 3300042652 | Bacteria | 7169 |
| 21 | Ga0466727_019997 | 3300042655 | Bacteria | 1221 |
| 22 | Ga0466705_071610 | 3300042612 | Bacteria | 13460 |
| 23 | Ga0466705_128991 | 3300042612 | Bacteria | 11303 |
| 24 | Ga0466705_246410 | 3300042612 | Bacteria | 1992 |
| 25 | Ga0123356_10686531 | 3300010049 | Bacteria | 1192 |
| 26 | Ga0123356_12802358 | 3300010049 | Bacteria | 610 |
| 27 | Ga0466690_064197 | 3300042590 | Bacteria | 1428 |
| 28 | Ga0466711_222576 | 3300042615 | Bacteria | 8667 |
| 29 | Ga0466711_384875 | 3300042615 | Bacteria | 47167 |
| 30 | Ga0466715_134828 | 3300042616 | Bacteria | 35442 |
| 31 | Ga0466715_286948 | 3300042616 | Bacteria | 13632 |
| 32 | IMNBL1DRAFT_c0008471 | 3300000062 | Bacteria | 5229 |
| 33 | JGI24705J35276_12160903 | 3300002504 | Bacteria | 1232 |
| 34 | JGI24696J40584_12953847 | 3300002834 | Bacteria | 2544 |
| 35 | Ga0466707_119472 | 3300042601 | Bacteria | 9937 |
| 36 | Ga0466713_087495 | 3300042602 | Bacteria | 10882 |
| 37 | Ga0466729_316363 | 3300042621 | Bacteria | 5483 |
| 38 | Ga0466735_226098 | 3300042624 | Bacteria | 3202 |
| 39 | Ga0466703_045963 | 3300042636 | Unclassified | 2737 |
| 40 | Ga0466709_378565 | 3300042648 | Bacteria | 2052 |
| 41 | Ga0466708_254700 | 3300042652 | Bacteria | 40254 |
| 42 | Ga0466725_372140 | 3300042654 | Bacteria | 27057 |
| 43 | Ga0466727_065441 | 3300042655 | Bacteria | 2493 |
| 44 | Ga0466727_346342 | 3300042655 | Bacteria | 4900 |
| 45 | Ga0466705_097582 | 3300042612 | Unclassified | 1686 |
| 46 | Ga0466733_014741 | 3300042659 | Bacteria | 52817 |
| 47 | Ga0123353_10507762 | 3300010167 | Bacteria | 1754 |
| 48 | Ga0466656_315259 | 3300042550 | Bacteria | 1499 |
| 49 | Ga0466690_268790 | 3300042590 | Bacteria | 12537 |
| 50 | Ga0466691_154870 | 3300042593 | Bacteria | 1076 |
| 51 | Ga0466705_472302 | 3300042612 | Unclassified | 7691 |
| 52 | Ga0466715_031414 | 3300042616 | Bacteria | 7074 |
| 53 | Ga0466728_427300 | 3300042620 | Bacteria | 6266 |
| 54 | Ga0466728_446198 | 3300042620 | Unclassified | 3048 |
| 55 | IMNBL1DRAFT_c0102199 | 3300000062 | Bacteria | 769 |
| 56 | Ga0466714_084062 | 3300042603 | Bacteria | 1093 |
| 57 | Ga0466725_201989 | 3300042654 | Bacteria | 20545 |
| 58 | Ga0466727_233746 | 3300042655 | Bacteria | 10448 |
| 59 | Ga0466697_230580 | 3300042611 | Bacteria | 1524 |
| 60 | Ga0466732_109749 | 3300042656 | Bacteria | 1884 |
| 61 | Ga0466733_117754 | 3300042659 | Bacteria | 7100 |
| 62 | Ga0466690_272093 | 3300042590 | Bacteria | 3525 |
| 63 | Ga0466696_016314 | 3300042596 | Bacteria | 8866 |
| 64 | Ga0466696_080846 | 3300042596 | Bacteria | 1417 |
| 65 | Ga0466715_107026 | 3300042616 | Bacteria | 6269 |
| 66 | Ga0466715_373317 | 3300042616 | Bacteria | 12645 |
| 67 | Ga0466715_439531 | 3300042616 | Bacteria | 13538 |
| 68 | Ga0466728_371699 | 3300042620 | Bacteria | 5586 |
| 69 | IMNBL1DRAFT_c0002548 | 3300000062 | Bacteria | 12583 |
| 70 | JGI24702J35022_10152367 | 3300002462 | Bacteria | 1298 |
| 71 | JGI24696J40584_12958040 | 3300002834 | Bacteria | 3845 |
| 72 | Ga0466701_081567 | 3300042598 | Bacteria | 1997 |
| 73 | Ga0466706_073156 | 3300042599 | Bacteria | 4541 |
| 74 | Ga0466703_153246 | 3300042636 | Bacteria | 7240 |
| 75 | Ga0466727_170500 | 3300042655 | Bacteria | 6367 |
| 76 | Ga0466733_038286 | 3300042659 | Bacteria | 266317 |
| 77 | Ga0466733_088000 | 3300042659 | Bacteria | 4445 |
| 78 | Ga0123353_12184902 | 3300010167 | Bacteria | 670 |
| 79 | Ga0160433_100342 | 3300012846 | Bacteria | 27928 |
| 80 | Ga0466657_068251 | 3300042582 | Bacteria | 20125 |
| 81 | Ga0466690_119560 | 3300042590 | Bacteria | 3252 |
| 82 | Ga0466692_022928 | 3300042591 | Bacteria | 2149 |
| 83 | Ga0466691_039068 | 3300042593 | Bacteria | 9188 |
| 84 | Ga0466691_072424 | 3300042593 | Bacteria | 10125 |
| 85 | Ga0466696_094787 | 3300042596 | Bacteria | 1237 |
| 86 | Ga0466696_186341 | 3300042596 | Bacteria | 8260 |
| 87 | Ga0466696_293409 | 3300042596 | Bacteria | 4885 |
| 88 | Ga0466711_325789 | 3300042615 | Bacteria | 11504 |
| 89 | Ga0466723_284877 | 3300042618 | Bacteria | 14758 |
| 90 | Ga0466729_107490 | 3300042621 | Bacteria | 2460 |
| 91 | JGI24702J35022_10068626 | 3300002462 | Bacteria | 1906 |
| 92 | Ga0068302_10027782 | 3300005071 | Bacteria | 7223 |
| 93 | Ga0466713_083078 | 3300042602 | Bacteria | 18366 |
| 94 | Ga0466716_191285 | 3300042605 | Bacteria | 1771 |
| 95 | Ga0466716_535289 | 3300042605 | Bacteria | 1913 |
| 96 | Ga0466719_517989 | 3300042606 | Bacteria | 5894 |
| 97 | Ga0466703_418540 | 3300042636 | Bacteria | 1352 |
| 98 | Ga0466709_123126 | 3300042648 | Bacteria | 5251 |
| 99 | Ga0466690_061665 | 3300042590 | Bacteria | 6718 |
| 100 | Ga0466690_122659 | 3300042590 | Bacteria | 11163 |
| 101 | Ga0466696_107761 | 3300042596 | Bacteria | 30257 |
| 102 | Ga0466711_117154 | 3300042615 | Bacteria | 17125 |
| 103 | Ga0466711_139037 | 3300042615 | Bacteria | 18954 |
| 104 | Ga0466711_204836 | 3300042615 | Bacteria | 21772 |
| 105 | Ga0466723_167469 | 3300042618 | Bacteria | 6711 |
| 106 | Ga0466728_287418 | 3300042620 | Bacteria | 1006 |
| 107 | IMNBL1DRAFT_c0005216 | 3300000062 | Bacteria | 7506 |
| 108 | JGI24702J35022_10681482 | 3300002462 | Bacteria | 638 |
| 109 | Ga0068305_10104140 | 3300005083 | Bacteria | 7124 |
| 110 | Ga0466707_063394 | 3300042601 | Bacteria | 26550 |
| 111 | Ga0466707_379457 | 3300042601 | Bacteria | 6166 |
| 112 | Ga0466713_087582 | 3300042602 | Bacteria | 12839 |
| 113 | Ga0466716_306257 | 3300042605 | Bacteria | 14675 |
| 114 | Ga0466735_159280 | 3300042624 | Bacteria | 2415 |
| 115 | Ga0466704_022411 | 3300042643 | Bacteria | 3764 |
| 116 | Ga0466704_033935 | 3300042643 | Bacteria | 4205 |
| 117 | Ga0466727_261367 | 3300042655 | Bacteria | 12029 |
| 118 | Ga0466697_106599 | 3300042611 | Bacteria | 91903 |
| 119 | Ga0466656_102351 | 3300042550 | Bacteria | 1098 |
| 120 | Ga0466690_053388 | 3300042590 | Bacteria | 18157 |
| 121 | Ga0466690_214107 | 3300042590 | Bacteria | 2978 |
| 122 | Ga0466696_264049 | 3300042596 | Bacteria | 1895 |
| 123 | Ga0466705_397640 | 3300042612 | Bacteria | 4830 |
| 124 | Ga0466711_359360 | 3300042615 | Bacteria | 14266 |
| 125 | Ga0466715_065792 | 3300042616 | Bacteria | 3459 |
| 126 | Ga0466715_073194 | 3300042616 | Bacteria | 7471 |
| 127 | Ga0466723_045427 | 3300042618 | Bacteria | 5231 |
| 128 | Ga0466723_048213 | 3300042618 | Bacteria | 35911 |
| 129 | Ga0466728_038037 | 3300042620 | Bacteria | 2665 |
| 130 | Ga0466728_119798 | 3300042620 | Bacteria | 9621 |
| 131 | Ga0466728_179341 | 3300042620 | Bacteria | 35746 |
| 132 | IMNBL1DRAFT_c0017133 | 3300000062 | Bacteria | 3067 |
| 133 | Ga0466707_078976 | 3300042601 | Bacteria | 10553 |
| 134 | Ga0466713_117586 | 3300042602 | Bacteria | 26755 |
| 135 | Ga0466703_006089 | 3300042636 | Bacteria | 13833 |
| 136 | Ga0466703_205652 | 3300042636 | Bacteria | 2589 |
| 137 | Ga0466708_067867 | 3300042652 | Bacteria | 4300 |
| 138 | Ga0466708_117680 | 3300042652 | Unclassified | 2132 |
| 139 | Ga0466727_026757 | 3300042655 | Bacteria | 1764 |
| 140 | Ga0466705_061372 | 3300042612 | Bacteria | 3173 |
| 141 | Ga0123353_10118971 | 3300010167 | Bacteria | 4248 |
| 142 | Ga0123353_10136583 | 3300010167 | Bacteria | 3932 |
| 143 | Ga0123353_10287963 | 3300010167 | Bacteria | 2517 |
| 144 | Ga0466657_340658 | 3300042582 | Unclassified | 1804 |
| 145 | Ga0466690_025734 | 3300042590 | Bacteria | 11601 |
| 146 | Ga0466690_168180 | 3300042590 | Bacteria | 14796 |
| 147 | Ga0466710_292378 | 3300042613 | Bacteria | 1838 |
| 148 | Ga0466711_328602 | 3300042615 | Bacteria | 5891 |
| 149 | Ga0466715_139422 | 3300042616 | Bacteria | 3530 |
| 150 | Ga0466715_358000 | 3300042616 | Bacteria | 3709 |
| 151 | Ga0466728_002157 | 3300042620 | Bacteria | 6333 |
| 152 | Ga0466728_158816 | 3300042620 | Bacteria | 9395 |
| 153 | Ga0466713_035920 | 3300042602 | Bacteria | 98273 |
| 154 | Ga0466716_230694 | 3300042605 | Bacteria | 14957 |
| 155 | Ga0466719_242337 | 3300042606 | Bacteria | 14756 |
| 156 | Ga0466719_274637 | 3300042606 | Bacteria | 3496 |
| 157 | Ga0466703_247716 | 3300042636 | Bacteria | 7183 |
| 158 | Ga0466704_340948 | 3300042643 | Bacteria | 2712 |
| 159 | Ga0466708_210049 | 3300042652 | Bacteria | 11481 |
| 160 | Ga0466727_191150 | 3300042655 | Bacteria | 17261 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF12850 | Metallophos_2 | Calcineurin-like phosphoesterase superfamily domain | 27 | 172 | 0.89 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.