Protein Family IF06444
Metagenome
Isolate
114
Members
31
Samples
112
Scaffolds
189.54
Avg Length
Representative Sequence
- ID
- 3300042606|Ga0466719_021664|Ga0466719_021664_267_899
- Length
- 210 aa
- Sequence
- VTPCRIQLPLTREKTAPLKAGDRVLLSGDIYTARDAAHKRLDELLDAKKPLPFPLEDACIYYVGPTPAAPGQIIGSAGPTTSYRMDAWAPRLLMLGLRGMIGKGERSEEVVRAMKWAGAVYLGALGGAGALLSQCVTGSRIIAFEDLGTEAIRLLTVKDFPATVVIDSRGENLYRSGRRAYLAARAHQEPIVLPSPAPPVNITGGGLHGD
Sample Types
Isolate
1.8%
Metagenome
98.2%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
45.2%
Termitidae
16.1%
Rhinotermitidae
9.7%
Unclassified
9.7%
Termopsidae
9.7%
Passalidae
6.5%
Hodotermitidae
3.2%
Taxonomy
Archaea
0
Bacteria
109
Eukaryota
0
Viruses
0
Unclassified
5
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 2 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 3 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 4 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 5 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 6 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 7 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 8 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 9 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 10 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 11 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 12 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 13 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 14 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 15 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 16 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 17 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 18 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 19 | 2820522177 | Unclassified Firmicutes Lab288P1bin22 | Isolate | Unclassified |
| 20 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 21 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 22 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 23 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 24 | 2820693137 | Unclassified Firmicutes Co191P1bin70 | Isolate | Unclassified |
| 25 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 26 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 27 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 28 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 29 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 30 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 31 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_255129 | 3300042612 | Bacteria | 11359 |
| 2 | Ga0466735_192353 | 3300042624 | Unclassified | 2111 |
| 3 | Ga0466709_246533 | 3300042648 | Bacteria | 16446 |
| 4 | Ga0466727_001921 | 3300042655 | Bacteria | 3403 |
| 5 | Ga0466727_303274 | 3300042655 | Bacteria | 1030 |
| 6 | Ga0466707_416659 | 3300042601 | Bacteria | 1711 |
| 7 | Ga0466716_326452 | 3300042605 | Bacteria | 4810 |
| 8 | Ga0466719_021664 | 3300042606 | Bacteria | 1199 |
| 9 | Ga0466722_027454 | 3300042609 | Bacteria | 32114 |
| 10 | Ga0466722_124740 | 3300042609 | Bacteria | 1519 |
| 11 | Ga0466723_331192 | 3300042618 | Bacteria | 5726 |
| 12 | Ga0466726_356469 | 3300042619 | Bacteria | 2558 |
| 13 | Ga0466728_045153 | 3300042620 | Bacteria | 1226 |
| 14 | Ga0466728_210085 | 3300042620 | Unclassified | 2602 |
| 15 | Ga0466735_127328 | 3300042624 | Bacteria | 2942 |
| 16 | Ga0466703_007205 | 3300042636 | Bacteria | 42180 |
| 17 | Ga0466704_126199 | 3300042643 | Bacteria | 5709 |
| 18 | Ga0466707_032665 | 3300042601 | Bacteria | 1846 |
| 19 | Ga0466707_045453 | 3300042601 | Bacteria | 1284 |
| 20 | Ga0466707_249073 | 3300042601 | Bacteria | 1091 |
| 21 | Ga0466716_069335 | 3300042605 | Bacteria | 2125 |
| 22 | Ga0466716_325081 | 3300042605 | Bacteria | 1230 |
| 23 | Ga0466722_079528 | 3300042609 | Bacteria | 2874 |
| 24 | Ga0466690_205609 | 3300042590 | Bacteria | 5139 |
| 25 | Ga0466690_288701 | 3300042590 | Bacteria | 6938 |
| 26 | Ga0466691_032751 | 3300042593 | Bacteria | 5391 |
| 27 | Ga0466696_234656 | 3300042596 | Bacteria | 6047 |
| 28 | Ga0466711_072886 | 3300042615 | Bacteria | 7173 |
| 29 | Ga0466726_218755 | 3300042619 | Bacteria | 1156 |
| 30 | Ga0466705_015050 | 3300042612 | Bacteria | 6941 |
| 31 | Ga0466705_203717 | 3300042612 | Bacteria | 1090 |
| 32 | Ga0466703_064839 | 3300042636 | Bacteria | 1651 |
| 33 | Ga0466703_409321 | 3300042636 | Bacteria | 56299 |
| 34 | Ga0466704_223677 | 3300042643 | Bacteria | 60624 |
| 35 | Ga0466708_333904 | 3300042652 | Bacteria | 4155 |
| 36 | Ga0466727_202142 | 3300042655 | Bacteria | 1291 |
| 37 | 2227639343 | 2225789004 | Bacteria | 2070 |
| 38 | IMNBL1DRAFT_c0005509 | 3300000062 | Bacteria | 7213 |
| 39 | Ga0466719_020754 | 3300042606 | Bacteria | 10559 |
| 40 | Ga0466715_122821 | 3300042616 | Bacteria | 43920 |
| 41 | Ga0466715_185543 | 3300042616 | Bacteria | 1759 |
| 42 | Ga0466723_148402 | 3300042618 | Bacteria | 14880 |
| 43 | Ga0466728_020098 | 3300042620 | Bacteria | 2683 |
| 44 | Ga0466705_105191 | 3300042612 | Bacteria | 20972 |
| 45 | Ga0466705_172368 | 3300042612 | Bacteria | 1293 |
| 46 | Ga0466702_227881 | 3300042635 | Bacteria | 4021 |
| 47 | Ga0466704_066501 | 3300042643 | Bacteria | 20063 |
| 48 | Ga0466709_305898 | 3300042648 | Bacteria | 5248 |
| 49 | Ga0466708_172528 | 3300042652 | Bacteria | 2961 |
| 50 | Ga0466708_462241 | 3300042652 | Bacteria | 17656 |
| 51 | Ga0466691_115395 | 3300042593 | Bacteria | 10127 |
| 52 | Ga0466696_121791 | 3300042596 | Bacteria | 4440 |
| 53 | Ga0466711_146877 | 3300042615 | Bacteria | 9604 |
| 54 | Ga0466726_204417 | 3300042619 | Bacteria | 13835 |
| 55 | Ga0466705_009414 | 3300042612 | Bacteria | 4547 |
| 56 | Ga0466703_092266 | 3300042636 | Bacteria | 37200 |
| 57 | Ga0466704_052736 | 3300042643 | Bacteria | 18411 |
| 58 | Ga0466708_062911 | 3300042652 | Bacteria | 5870 |
| 59 | Ga0466708_168820 | 3300042652 | Bacteria | 4659 |
| 60 | Ga0456237_0000515 | 3300041968 | Bacteria | 5891 |
| 61 | Ga0466691_177940 | 3300042593 | Bacteria | 20777 |
| 62 | Ga0466696_012033 | 3300042596 | Bacteria | 20107 |
| 63 | Ga0466726_420962 | 3300042619 | Bacteria | 8055 |
| 64 | Ga0466729_160753 | 3300042621 | Bacteria | 1102 |
| 65 | Ga0466705_200303 | 3300042612 | Bacteria | 16226 |
| 66 | Ga0123355_10617961 | 3300009826 | Bacteria | 1279 |
| 67 | Ga0466735_137529 | 3300042624 | Bacteria | 2297 |
| 68 | Ga0466703_220845 | 3300042636 | Bacteria | 51302 |
| 69 | Ga0466703_296108 | 3300042636 | Bacteria | 6430 |
| 70 | Ga0466716_479700 | 3300042605 | Bacteria | 5510 |
| 71 | Ga0466719_073800 | 3300042606 | Bacteria | 2792 |
| 72 | Ga0466719_180187 | 3300042606 | Bacteria | 25290 |
| 73 | Ga0466722_018130 | 3300042609 | Bacteria | 5521 |
| 74 | Ga0466690_003566 | 3300042590 | Bacteria | 12645 |
| 75 | Ga0466691_004766 | 3300042593 | Bacteria | 3131 |
| 76 | Ga0466715_058205 | 3300042616 | Bacteria | 15173 |
| 77 | Ga0466715_077465 | 3300042616 | Bacteria | 1930 |
| 78 | Ga0466715_122380 | 3300042616 | Bacteria | 2041 |
| 79 | Ga0466723_003996 | 3300042618 | Bacteria | 19196 |
| 80 | Ga0466723_374434 | 3300042618 | Bacteria | 1410 |
| 81 | Ga0466728_069712 | 3300042620 | Bacteria | 1339 |
| 82 | Ga0466728_182556 | 3300042620 | Bacteria | 2183 |
| 83 | Ga0466703_135593 | 3300042636 | Bacteria | 14337 |
| 84 | Ga0466704_099104 | 3300042643 | Bacteria | 24492 |
| 85 | Ga0466704_246960 | 3300042643 | Bacteria | 12341 |
| 86 | Ga0466704_426663 | 3300042643 | Bacteria | 3100 |
| 87 | Ga0466709_000202 | 3300042648 | Bacteria | 1183 |
| 88 | Ga0466727_153892 | 3300042655 | Bacteria | 4771 |
| 89 | Ga0466727_202357 | 3300042655 | Bacteria | 7140 |
| 90 | Ga0466706_168447 | 3300042599 | Bacteria | 1795 |
| 91 | Ga0415639_000074 | 3300038395 | Bacteria | 109555 |
| 92 | Ga0466696_188902 | 3300042596 | Bacteria | 4598 |
| 93 | Ga0466711_202959 | 3300042615 | Bacteria | 30412 |
| 94 | Ga0466723_024084 | 3300042618 | Bacteria | 42350 |
| 95 | Ga0466723_100034 | 3300042618 | Unclassified | 5470 |
| 96 | Ga0466723_129761 | 3300042618 | Bacteria | 3219 |
| 97 | Ga0466726_314279 | 3300042619 | Bacteria | 1152 |
| 98 | Ga0123356_10009306 | 3300010049 | Bacteria | 9704 |
| 99 | Ga0466735_025271 | 3300042624 | Bacteria | 18955 |
| 100 | Ga0466704_066260 | 3300042643 | Unclassified | 8237 |
| 101 | Ga0466709_093473 | 3300042648 | Bacteria | 4798 |
| 102 | Ga0466709_319192 | 3300042648 | Unclassified | 1059 |
| 103 | Ga0466709_339539 | 3300042648 | Bacteria | 5321 |
| 104 | Ga0466727_337047 | 3300042655 | Bacteria | 1121 |
| 105 | Ga0466707_344095 | 3300042601 | Bacteria | 1046 |
| 106 | Ga0466716_252034 | 3300042605 | Bacteria | 8548 |
| 107 | Ga0466722_193755 | 3300042609 | Bacteria | 1440 |
| 108 | Ga0466691_034660 | 3300042593 | Bacteria | 57357 |
| 109 | Ga0466696_423691 | 3300042596 | Bacteria | 31979 |
| 110 | Ga0466718_015496 | 3300042617 | Bacteria | 1364 |
| 111 | Ga0466723_021558 | 3300042618 | Bacteria | 2024 |
| 112 | Ga0466729_092677 | 3300042621 | Bacteria | 1311 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF05683 | Fumerase_C | Fumarase C-terminus | 9 | 176 | 0.96 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF05683 | GO:0016836 | hydro-lyase activity | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.