Protein Family IF06441
Metagenome
Metatranscriptome
Isolate
213
Members
69
Samples
196
Scaffolds
335.04
Avg Length
Representative Sequence
- ID
- 3300042606|Ga0466719_015134|Ga0466719_015134_2725_3765
- Length
- 346 aa
- Sequence
- MGKVVSFGEIMLRLAPEGYYRFVQASSFGAVYGGGEANVAISLANYGVDSVFVTKLPKHEIGQAAVNTLRAFGVDTSRIVRGGNRVGIYFLEKGASQRPSKVIYDRAGSAIAAASASDFDWDAIFGGSSAADSASWFHFTGITPALGDNVADITLEAVKKAKAKGLTVSCDLNYRKNLWSREKAGEVMGKIVPHVDLCIANEEDAADVFGIKAKDTDISSGALSREGYKDVAKALAGRFGFRQVAITLRESLSANDNNWAAMLYDGGEFYFSKKYAVRIVDRVGGGDSFGAGLIYGGLQKWPAAETLEFAVAASCLKHSIEGDYNLVSVDEVKKLAGGDASGRVQR
Sample Types
Isolate
8.0%
Metagenome
91.5%
MAG
0.0%
Metatranscriptome
0.5%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
33.8%
Unclassified
29.2%
Kalotermitidae
21.5%
Rhinotermitidae
4.6%
Termopsidae
4.6%
Passalidae
3.1%
Blaberidae
1.5%
Hodotermitidae
1.5%
Taxonomy
Archaea
1
Bacteria
197
Eukaryota
0
Viruses
0
Unclassified
15
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820259584 | Unclassified Firmicutes Th196P3bin43 | Isolate | Unclassified |
| 2 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 3 | 3300002508 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 | Metagenome | Termitidae |
| 4 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 5 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 6 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 7 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 8 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 9 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 10 | 2772190975 | Treponema sp. RmG30 | Isolate | Blaberidae |
| 11 | 2781125637 | Treponema sp. Co191P1bin9 | Isolate | Unclassified |
| 12 | 2781125642 | Treponema sp. Co191P1bin35 | Isolate | Unclassified |
| 13 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 14 | 2820431532 | Unclassified Firmicutes Lab288P3bin230 | Isolate | Unclassified |
| 15 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 16 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 17 | 3300021235 | Termite gut microbial communities from nest from French Guiana - FG16_2_6 mRNA SA | Metatranscriptome | |
| 18 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 19 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 20 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 21 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 22 | 2781125688 | Treponema sp. Lab288P4bin13 | Isolate | Unclassified |
| 23 | 2820005795 | Unclassified Synergistetes Nt197P3bin106 | Isolate | Unclassified |
| 24 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 25 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 26 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 27 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 28 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 29 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 30 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 31 | 2781125660 | Treponema sp. Emb289P3bin52 | Isolate | Unclassified |
| 32 | 2820004052 | Unclassified Synergistetes Nt197P3bin25 | Isolate | Unclassified |
| 33 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 34 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 35 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 36 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 37 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 38 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 39 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 40 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 41 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 42 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 43 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 44 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 45 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 46 | 2781125638 | Treponema sp. Co191P1bin8 | Isolate | Unclassified |
| 47 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 48 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 49 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 50 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 51 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 52 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 53 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 54 | 2781125635 | Treponema sp. Co191P1bin60 | Isolate | Unclassified |
| 55 | 2781125636 | Treponema sp. Co191P1bin67 | Isolate | Unclassified |
| 56 | 2820600392 | Unclassified Firmicutes Emb289P1bin52 | Isolate | Unclassified |
| 57 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 58 | 3300001880 | Termite hindgut microbial communities from the Max Planck Institute, Bremen, Germany, analyzing fibers in the hindgut lumen - ASSEMBLED Fiber-Associated Metagenome | Metagenome | |
| 59 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 60 | 2781125644 | Treponema sp. Co191P3bin12 | Isolate | Unclassified |
| 61 | 2781125645 | Treponema sp. Co191P3bin32 | Isolate | Unclassified |
| 62 | 2781125665 | Treponema sp. Emb289P3bin117 | Isolate | Unclassified |
| 63 | 2820615445 | Unclassified Firmicutes Emb289P1bin132 | Isolate | Unclassified |
| 64 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 65 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 66 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 67 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 68 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 69 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466706_036878 | 3300042599 | Bacteria | 3335 |
| 2 | Ga0466706_262770 | 3300042599 | Bacteria | 2372 |
| 3 | Ga0466722_029574 | 3300042609 | Bacteria | 17025 |
| 4 | Ga0466722_103483 | 3300042609 | Bacteria | 3225 |
| 5 | Ga0466722_158543 | 3300042609 | Bacteria | 3790 |
| 6 | Ga0466722_208865 | 3300042609 | Bacteria | 10839 |
| 7 | Ga0466691_159452 | 3300042593 | Bacteria | 2365 |
| 8 | Ga0466696_383085 | 3300042596 | Bacteria | 5911 |
| 9 | Ga0466699_217538 | 3300042597 | Bacteria | 3700 |
| 10 | Ga0466712_141805 | 3300042614 | Bacteria | 2822 |
| 11 | Ga0466712_324221 | 3300042614 | Bacteria | 24128 |
| 12 | Ga0466711_064111 | 3300042615 | Bacteria | 3527 |
| 13 | Ga0466718_036909 | 3300042617 | Bacteria | 3913 |
| 14 | Ga0466726_153501 | 3300042619 | Bacteria | 1895 |
| 15 | Ga0466726_162794 | 3300042619 | Bacteria | 2934 |
| 16 | Ga0466732_121898 | 3300042656 | Bacteria | 6061 |
| 17 | Ga0466700_122225 | 3300042600 | Bacteria | 1470 |
| 18 | Ga0466722_066483 | 3300042609 | Bacteria | 3300 |
| 19 | Ga0466722_098966 | 3300042609 | Bacteria | 13569 |
| 20 | Ga0223674_1018479 | 3300021235 | Bacteria | 1541 |
| 21 | Ga0264413_108277 | 3300024493 | Unclassified | 3479 |
| 22 | Ga0466692_158202 | 3300042591 | Bacteria | 1457 |
| 23 | Ga0466694_129478 | 3300042594 | Bacteria | 2487 |
| 24 | Ga0466696_340021 | 3300042596 | Bacteria | 3026 |
| 25 | Ga0466699_378068 | 3300042597 | Bacteria | 2838 |
| 26 | Ga0466699_440334 | 3300042597 | Bacteria | 8698 |
| 27 | Ga0123357_10124765 | 3300009784 | Bacteria | 3229 |
| 28 | Ga0123356_10004904 | 3300010049 | Bacteria | 13734 |
| 29 | Ga0123356_10080807 | 3300010049 | Bacteria | 3074 |
| 30 | Ga0123356_10307721 | 3300010049 | Bacteria | 1692 |
| 31 | IMNBL1DRAFT_c0000798 | 3300000062 | Bacteria | 24848 |
| 32 | AustNasuHG_c1000419 | 3300000089 | Bacteria | 14740 |
| 33 | Ga0072941_1015655 | 3300005201 | Bacteria | 5017 |
| 34 | Ga0466705_082688 | 3300042612 | Bacteria | 9656 |
| 35 | Ga0466705_192647 | 3300042612 | Unclassified | 1763 |
| 36 | Ga0466703_042026 | 3300042636 | Unclassified | 6256 |
| 37 | Ga0466704_047030 | 3300042643 | Bacteria | 17731 |
| 38 | Ga0466704_291127 | 3300042643 | Bacteria | 4060 |
| 39 | Ga0466708_050775 | 3300042652 | Bacteria | 6575 |
| 40 | Ga0466727_255814 | 3300042655 | Bacteria | 4037 |
| 41 | Ga0466712_083934 | 3300042614 | Bacteria | 6894 |
| 42 | Ga0466715_029667 | 3300042616 | Bacteria | 2898 |
| 43 | Ga0466715_211982 | 3300042616 | Bacteria | 25109 |
| 44 | Ga0466715_634144 | 3300042616 | Bacteria | 5035 |
| 45 | Ga0466700_190554 | 3300042600 | Bacteria | 1107 |
| 46 | Ga0466707_050599 | 3300042601 | Bacteria | 3594 |
| 47 | Ga0466716_058560 | 3300042605 | Unclassified | 6904 |
| 48 | Ga0466721_087343 | 3300042608 | Bacteria | 13602 |
| 49 | Ga0466690_246341 | 3300042590 | Bacteria | 3645 |
| 50 | Ga0466691_049544 | 3300042593 | Bacteria | 2295 |
| 51 | Ga0466699_227845 | 3300042597 | Bacteria | 18629 |
| 52 | Ga0466699_230969 | 3300042597 | Bacteria | 2627 |
| 53 | Ga0123355_10078800 | 3300009826 | Bacteria | 5263 |
| 54 | Ga0123356_10000102 | 3300010049 | Bacteria | 90045 |
| 55 | Ga0123356_10003889 | 3300010049 | Bacteria | 15553 |
| 56 | Ga0068305_10042695 | 3300005083 | Bacteria | 4530 |
| 57 | Ga0072941_1005089 | 3300005201 | Bacteria | 26692 |
| 58 | Ga0466705_260771 | 3300042612 | Bacteria | 12007 |
| 59 | Ga0466731_424895 | 3300042622 | Bacteria | 5640 |
| 60 | Ga0466704_024511 | 3300042643 | Bacteria | 22738 |
| 61 | Ga0466727_308151 | 3300042655 | Bacteria | 6590 |
| 62 | Ga0466727_342017 | 3300042655 | Bacteria | 4088 |
| 63 | Ga0466712_023839 | 3300042614 | Bacteria | 59773 |
| 64 | Ga0466715_540753 | 3300042616 | Bacteria | 2183 |
| 65 | Ga0466718_001593 | 3300042617 | Unclassified | 3233 |
| 66 | Ga0466718_004107 | 3300042617 | Unclassified | 2963 |
| 67 | Ga0466728_146765 | 3300042620 | Bacteria | 4325 |
| 68 | Ga0466732_196571 | 3300042656 | Bacteria | 8181 |
| 69 | Ga0466732_325943 | 3300042656 | Bacteria | 2371 |
| 70 | Ga0466706_104549 | 3300042599 | Bacteria | 39465 |
| 71 | Ga0466713_150845 | 3300042602 | Bacteria | 1673 |
| 72 | Ga0466719_080191 | 3300042606 | Bacteria | 4136 |
| 73 | Ga0466722_078639 | 3300042609 | Bacteria | 8990 |
| 74 | Ga0466722_153642 | 3300042609 | Bacteria | 9464 |
| 75 | Ga0466693_356149 | 3300042592 | Unclassified | 2486 |
| 76 | Ga0466693_436842 | 3300042592 | Bacteria | 1148 |
| 77 | Ga0466691_025039 | 3300042593 | Bacteria | 10451 |
| 78 | Ga0466694_011023 | 3300042594 | Bacteria | 13854 |
| 79 | Ga0466694_354436 | 3300042594 | Bacteria | 1113 |
| 80 | Ga0466699_015137 | 3300042597 | Bacteria | 9171 |
| 81 | Ga0466699_070326 | 3300042597 | Bacteria | 7676 |
| 82 | Ga0466699_210705 | 3300042597 | Bacteria | 11283 |
| 83 | Ga0466699_438631 | 3300042597 | Bacteria | 3434 |
| 84 | Ga0123355_10159360 | 3300009826 | Bacteria | 3404 |
| 85 | Ga0123356_10002625 | 3300010049 | Bacteria | 19131 |
| 86 | Ga0123356_10011884 | 3300010049 | Bacteria | 8475 |
| 87 | Ga0123353_10437718 | 3300010167 | Bacteria | 1930 |
| 88 | Ga0123353_10537897 | 3300010167 | Bacteria | 1689 |
| 89 | Ga0123353_10916672 | 3300010167 | Bacteria | 1190 |
| 90 | Ga0123354_10053305 | 3300010882 | Bacteria | 6083 |
| 91 | JGI24698J34947_10037096 | 3300002449 | Bacteria | 2534 |
| 92 | JGI24700J35501_10929007 | 3300002508 | Bacteria | 8418 |
| 93 | Ga0466735_021647 | 3300042624 | Bacteria | 2949 |
| 94 | Ga0466735_040660 | 3300042624 | Bacteria | 16748 |
| 95 | Ga0466704_256078 | 3300042643 | Bacteria | 10591 |
| 96 | Ga0466704_310846 | 3300042643 | Unclassified | 2485 |
| 97 | Ga0466704_607960 | 3300042643 | Bacteria | 3308 |
| 98 | Ga0466709_040759 | 3300042648 | Archaea | 6298 |
| 99 | Ga0466708_182701 | 3300042652 | Bacteria | 11271 |
| 100 | Ga0466708_205678 | 3300042652 | Bacteria | 2608 |
| 101 | Ga0466727_184141 | 3300042655 | Bacteria | 2974 |
| 102 | Ga0466715_361708 | 3300042616 | Bacteria | 1337 |
| 103 | Ga0466723_117408 | 3300042618 | Unclassified | 6111 |
| 104 | Ga0466723_227008 | 3300042618 | Bacteria | 1850 |
| 105 | Ga0466732_405369 | 3300042656 | Bacteria | 1432 |
| 106 | Ga0466706_029878 | 3300042599 | Bacteria | 6551 |
| 107 | Ga0466713_025243 | 3300042602 | Bacteria | 12014 |
| 108 | Ga0466716_038207 | 3300042605 | Bacteria | 7844 |
| 109 | Ga0466719_015134 | 3300042606 | Bacteria | 14573 |
| 110 | Ga0466720_088196 | 3300042607 | Bacteria | 9313 |
| 111 | Ga0415639_040202 | 3300038395 | Bacteria | 6486 |
| 112 | Ga0466691_157145 | 3300042593 | Bacteria | 6281 |
| 113 | Ga0466694_132910 | 3300042594 | Bacteria | 6339 |
| 114 | Ga0123356_10000020 | 3300010049 | Bacteria | 177064 |
| 115 | Ga0123356_10014973 | 3300010049 | Bacteria | 7441 |
| 116 | Ga0123356_10043824 | 3300010049 | Bacteria | 4166 |
| 117 | JGI24698J34947_10014316 | 3300002449 | Bacteria | 4319 |
| 118 | JGI24698J34947_10021784 | 3300002449 | Bacteria | 3443 |
| 119 | JGI24698J34947_10022366 | 3300002449 | Bacteria | 3391 |
| 120 | JGI24695J34938_10005656 | 3300002450 | Bacteria | 7723 |
| 121 | Ga0466703_154163 | 3300042636 | Bacteria | 8518 |
| 122 | Ga0466711_344992 | 3300042615 | Bacteria | 71415 |
| 123 | Ga0466718_018540 | 3300042617 | Bacteria | 5648 |
| 124 | Ga0466726_029733 | 3300042619 | Bacteria | 2285 |
| 125 | Ga0466726_048293 | 3300042619 | Bacteria | 7289 |
| 126 | Ga0466706_093362 | 3300042599 | Bacteria | 11051 |
| 127 | Ga0466719_209678 | 3300042606 | Bacteria | 3101 |
| 128 | Ga0466720_156005 | 3300042607 | Bacteria | 2888 |
| 129 | Ga0466722_145100 | 3300042609 | Bacteria | 4226 |
| 130 | Ga0466722_212613 | 3300042609 | Bacteria | 4083 |
| 131 | Ga0466699_000327 | 3300042597 | Bacteria | 4302 |
| 132 | Ga0123353_10209219 | 3300010167 | Bacteria | 3061 |
| 133 | 2227191892 | 2225789004 | Bacteria | 35068 |
| 134 | JGI24698J34947_10005332 | 3300002449 | Unclassified | 7055 |
| 135 | JGI24698J34947_10013851 | 3300002449 | Bacteria | 4396 |
| 136 | JGI24698J34947_10051418 | 3300002449 | Bacteria | 2072 |
| 137 | JGI24695J34938_10001098 | 3300002450 | Bacteria | 24415 |
| 138 | Ga0068305_10066501 | 3300005083 | Bacteria | 27188 |
| 139 | Ga0466705_176893 | 3300042612 | Bacteria | 18426 |
| 140 | Ga0466731_194149 | 3300042622 | Bacteria | 2648 |
| 141 | Ga0466703_162319 | 3300042636 | Bacteria | 4772 |
| 142 | Ga0466704_073100 | 3300042643 | Bacteria | 1966 |
| 143 | Ga0466704_134440 | 3300042643 | Bacteria | 13173 |
| 144 | Ga0466704_239173 | 3300042643 | Unclassified | 2761 |
| 145 | Ga0466704_312403 | 3300042643 | Bacteria | 12291 |
| 146 | Ga0466708_121987 | 3300042652 | Bacteria | 6413 |
| 147 | Ga0466712_093151 | 3300042614 | Bacteria | 9642 |
| 148 | Ga0466711_254022 | 3300042615 | Bacteria | 2799 |
| 149 | Ga0466718_024373 | 3300042617 | Bacteria | 1434 |
| 150 | Ga0466718_143958 | 3300042617 | Unclassified | 2550 |
| 151 | Ga0466728_063548 | 3300042620 | Bacteria | 15903 |
| 152 | Ga0466732_348092 | 3300042656 | Bacteria | 1951 |
| 153 | Ga0466714_023456 | 3300042603 | Bacteria | 4676 |
| 154 | Ga0466690_046465 | 3300042590 | Bacteria | 3834 |
| 155 | Ga0466692_058765 | 3300042591 | Bacteria | 30559 |
| 156 | Ga0466691_166820 | 3300042593 | Bacteria | 3701 |
| 157 | Ga0466696_039164 | 3300042596 | Bacteria | 15910 |
| 158 | Ga0466696_389292 | 3300042596 | Bacteria | 3217 |
| 159 | Ga0123355_10000180 | 3300009826 | Bacteria | 77979 |
| 160 | Ga0123355_10113592 | 3300009826 | Unclassified | 4224 |
| 161 | Ga0123356_10012270 | 3300010049 | Bacteria | 8324 |
| 162 | JGI24695J34938_10003252 | 3300002450 | Bacteria | 11491 |
| 163 | JGI24695J34938_10006857 | 3300002450 | Bacteria | 6762 |
| 164 | Ga0072941_1001621 | 3300005201 | Bacteria | 12737 |
| 165 | Ga0466705_195432 | 3300042612 | Bacteria | 12968 |
| 166 | Ga0466705_198459 | 3300042612 | Bacteria | 1175 |
| 167 | Ga0466735_176124 | 3300042624 | Bacteria | 7554 |
| 168 | Ga0466703_059219 | 3300042636 | Bacteria | 6819 |
| 169 | Ga0466708_162546 | 3300042652 | Bacteria | 2025 |
| 170 | Ga0466711_256828 | 3300042615 | Bacteria | 13129 |
| 171 | Ga0466715_131917 | 3300042616 | Bacteria | 2089 |
| 172 | Ga0466715_184975 | 3300042616 | Bacteria | 35546 |
| 173 | Ga0466718_115653 | 3300042617 | Unclassified | 2087 |
| 174 | Ga0466726_321997 | 3300042619 | Bacteria | 3553 |
| 175 | Ga0466728_266461 | 3300042620 | Bacteria | 4806 |
| 176 | Ga0466706_113831 | 3300042599 | Bacteria | 22541 |
| 177 | Ga0466714_078213 | 3300042603 | Bacteria | 1608 |
| 178 | Ga0466716_104451 | 3300042605 | Bacteria | 6681 |
| 179 | Ga0466719_136527 | 3300042606 | Bacteria | 3158 |
| 180 | Ga0466719_260442 | 3300042606 | Unclassified | 2289 |
| 181 | Ga0466720_092256 | 3300042607 | Bacteria | 14355 |
| 182 | Ga0466722_185859 | 3300042609 | Bacteria | 2210 |
| 183 | Ga0466722_233436 | 3300042609 | Bacteria | 7475 |
| 184 | Ga0415639_046733 | 3300038395 | Bacteria | 3622 |
| 185 | Ga0456237_0011250 | 3300041968 | Bacteria | 1311 |
| 186 | Ga0466694_218098 | 3300042594 | Bacteria | 2289 |
| 187 | Ga0123355_10000304 | 3300009826 | Bacteria | 63149 |
| 188 | Ga0123353_10478172 | 3300010167 | Bacteria | 1824 |
| 189 | FAAS_10000147 | 3300001880 | Bacteria | 2776 |
| 190 | JGI24698J34947_10010685 | 3300002449 | Bacteria | 5039 |
| 191 | JGI24695J34938_10001168 | 3300002450 | Bacteria | 23337 |
| 192 | Ga0072940_1080136 | 3300005200 | Bacteria | 3289 |
| 193 | Ga0466705_251367 | 3300042612 | Bacteria | 4597 |
| 194 | Ga0466703_107678 | 3300042636 | Bacteria | 4683 |
| 195 | Ga0466704_115011 | 3300042643 | Bacteria | 11950 |
| 196 | Ga0466709_097736 | 3300042648 | Bacteria | 2295 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00294 | PfkB | pfkB family carbohydrate kinase | 1 | 320 | 0.86 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.