Protein Family IF06429
Metagenome
Isolate
151
Members
91
Samples
124
Scaffolds
360.13
Avg Length
Representative Sequence
- ID
- 3300042605|Ga0466716_496101|Ga0466716_496101_4101_5282
- Length
- 384 aa
- Sequence
- MEIKVQDDMASFFNEKGSLSQLIEKEFFIMKRKCLVSSLLASSYAAENVRFEPLIIQEQGSFAVGGTVVTTPGTFDPNNLIKPDGQTFHGDHAYVFYQVPVNPRKLPLVFLHGAGQFSKTWETTPDGRDGFQNIFLRRGFATYLLDQPRRGGAGRSTMPAELKPTADEQMWFTIFRLGNWPDFHPGVQFPQDEESLNQYFRQMTPNTGPYDDQVISDAIVALFDKLDDGILVTHSQGGGPGWYTAIKSAKVRAVISYEPGAFFFPEGEVPEPLPSSSPFGALKGVGVPMDDFLKLTKLPIVLYFGDNIPEEPTDDPGKDNWRTRLQMAKSWVAAINKHGGNAKLVHLPKIGITGNTHFPFSDLNNIEVADQMSKFLKENGLDSM
Sample Types
Isolate
17.2%
Metagenome
82.8%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
15.2%
Culicidae
12.7%
Formicidae
12.7%
Termitidae
10.1%
Armadillidiidae
10.1%
Unclassified
8.9%
Drosophilidae
7.6%
Rhinotermitidae
5.1%
Curculionidae
5.1%
Elmidae
2.5%
Ceratophyllidae
1.3%
Hydrophilidae
1.3%
Cerambycidae
1.3%
Carabidae
1.3%
Blattidae
1.3%
Passalidae
1.3%
Gryllidae
1.3%
Termopsidae
1.3%
Taxonomy
Archaea
1
Bacteria
139
Eukaryota
0
Viruses
0
Unclassified
11
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2519899622 | Pseudomonas sp. Ag1 | Isolate | Culicidae |
| 2 | 2864761044 | Stenotrophomonas rhizophilia S00008 | Isolate | Elmidae |
| 3 | 2898741527 | Sphingobacterium sp. xlx-73 | Isolate | |
| 4 | 3004010258 | Citrobacter sp. JGM124 | Isolate | Drosophilidae |
| 5 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 6 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 7 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 8 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 9 | 8006199443 | Yersinia pestis M-1763 | Isolate | Ceratophyllidae |
| 10 | 8100455565 | Delftia sp. S67 | Isolate | Curculionidae |
| 11 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 12 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 13 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 14 | 3300002934 | Ant worker gut metagenome for colony PL005 | Metagenome | Formicidae |
| 15 | 3300007052 | Ant gut microbial communities from Cephalotes eduarduli, Brazil | Metagenome | Formicidae |
| 16 | 3300007080 | Ant gut microbial communities from Cephalotes clypeatus, Brazil | Metagenome | Formicidae |
| 17 | 3300007153 | Drosophila gut microbial communities from New York, USA - Drosophila putrida male 3 gut | Metagenome | Drosophilidae |
| 18 | 3300012829 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG | Metagenome | Armadillidiidae |
| 19 | 3300012839 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG | Metagenome | Culicidae |
| 20 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 21 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 22 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 23 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 24 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 25 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 26 | 2864937364 | Acidovorax soli S00198 | Isolate | Elmidae |
| 27 | 2873776654 | Pedobacter sp. HDW13 | Isolate | Hydrophilidae |
| 28 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 29 | 3300012818 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E0 MG | Metagenome | |
| 30 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 31 | 3300012857 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG | Metagenome | Culicidae |
| 32 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 33 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 34 | 8062647588 | Nissabacter archeti JGM97 | Isolate | Drosophilidae |
| 35 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 36 | 2847708326 | Serratia liquefaciens P2ACOL2 | Isolate | Cerambycidae |
| 37 | 2896321640 | Sphingobacterium sp. xlx-130 | Isolate | |
| 38 | 3300007085 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut | Metagenome | Drosophilidae |
| 39 | 3300007188 | Ant gut microbial communities from Cephalotes rohweri, Arizona, USA | Metagenome | Formicidae |
| 40 | 3300012824 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG | Metagenome | Armadillidiidae |
| 41 | 3300012831 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E6 MG | Metagenome | Culicidae |
| 42 | 3300012835 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG | Metagenome | Culicidae |
| 43 | 3300012849 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG | Metagenome | Culicidae |
| 44 | 3300012850 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E0 MG | Metagenome | Culicidae |
| 45 | 3300012854 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG | Metagenome | Culicidae |
| 46 | 8004118532 | Citrobacter amalonaticus ku-bf3 | Isolate | Carabidae |
| 47 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 48 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 49 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 50 | 2837516909 | Rahnella bruchi DSM 27398 | Isolate | Unclassified |
| 51 | 2896330536 | Sphingobacterium sp. xlx-96 | Isolate | |
| 52 | 2978102237 | Serratia fonticola AeS1 | Isolate | Culicidae |
| 53 | 3300002464 | Anopheles gambiae gut viral communities from New Mexico State University, USA - SM1 | Metagenome | Culicidae |
| 54 | 3300007083 | Ant gut microbial communities from Cephalotes persimilis, Brazil | Metagenome | Formicidae |
| 55 | 3300007140 | Ant gut microbial communities from Cephalotes pallens, Brazil | Metagenome | Formicidae |
| 56 | 3300007143 | Drosophila gut microbial communities from New York, USA - Drosophila putrida female 3 gut | Metagenome | Drosophilidae |
| 57 | 3300012809 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E11 MG | Metagenome | |
| 58 | 3300012819 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E11 MG | Metagenome | Armadillidiidae |
| 59 | 3300012858 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG | Metagenome | Armadillidiidae |
| 60 | 8100461708 | Delftia sp. S65 | Isolate | Curculionidae |
| 61 | 2035918003 | Mountain Pine Beetle microbial communities from McBride, British Columbia, Canada - Lodgepole pine | Metagenome | Curculionidae |
| 62 | 2830041218 | Bacteroides reticulotermitis DSM 105720 | Isolate | Unclassified |
| 63 | 2910942425 | Dysgonomonas sp. 521 | Isolate | Blattidae |
| 64 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 65 | 3300007095 | Ant gut microbial communities from Cephalotes minutus, Brazil | Metagenome | Formicidae |
| 66 | 3300012828 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E0 MG | Metagenome | |
| 67 | 3300012841 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E1 MG | Metagenome | Armadillidiidae |
| 68 | 3300012847 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG | Metagenome | Armadillidiidae |
| 69 | 3300012852 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG | Metagenome | |
| 70 | 8100166142 | Dysgonomonas sp. GY75 | Isolate | Rhinotermitidae |
| 71 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 72 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 73 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 74 | 2896350215 | Sphingobacterium sp. xlx-183 | Isolate | |
| 75 | 2938192669 | Citrobacter sp. TSA-1 | Isolate | Unclassified |
| 76 | 2971189173 | Yersinia pestis A-1249 | Isolate | Unclassified |
| 77 | 3000478755 | Entomomonas asaccharolytica F2A | Isolate | Gryllidae |
| 78 | 3300007150 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 3 gut | Metagenome | Drosophilidae |
| 79 | 3300012805 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E11 MG | Metagenome | |
| 80 | 3300012814 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E6 MG | Metagenome | |
| 81 | 3300030930 | Ant gut bacterial community from Pseudomyrmex nigropilosus larvae, the Area de Conservacion Guanacaste, Costa Rica - colony BER0554 | Metagenome | Formicidae |
| 82 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 83 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 84 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 85 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 86 | 2571042003 | Stenoxybacter acetivorans DSM 19021 | Isolate | Rhinotermitidae |
| 87 | 2636416028 | Pelosinus propionicus DSM 13327 | Isolate | Unclassified |
| 88 | 3300007139 | Ant gut microbial communities from Cephalotes pellans, Brazil | Metagenome | Formicidae |
| 89 | 3300012825 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG | Metagenome | |
| 90 | 3300012848 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG | Metagenome | Armadillidiidae |
| 91 | 8100449422 | Delftia sp. S66 | Isolate | Curculionidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0160469_101992 | 3300012824 | Bacteria | 4408 |
| 2 | Ga0160435_1010757 | 3300012857 | Unclassified | 1888 |
| 3 | Ga0466730_020669 | 3300042625 | Bacteria | 6226 |
| 4 | Ga0466703_164075 | 3300042636 | Bacteria | 13137 |
| 5 | Ga0466709_099793 | 3300042648 | Bacteria | 27054 |
| 6 | Ga0466700_362165 | 3300042600 | Bacteria | 4813 |
| 7 | CVPL010W_10011854 | 3300002931 | Bacteria | 7620 |
| 8 | Ga0466711_173727 | 3300042615 | Bacteria | 1992 |
| 9 | Ga0466715_281004 | 3300042616 | Bacteria | 14784 |
| 10 | Ga0466729_075532 | 3300042621 | Bacteria | 4438 |
| 11 | Ga0160468_100104 | 3300012819 | Bacteria | 93524 |
| 12 | Ga0160468_100143 | 3300012819 | Bacteria | 66884 |
| 13 | Ga0160472_100619 | 3300012839 | Unclassified | 19032 |
| 14 | Ga0160444_100164 | 3300012841 | Bacteria | 65564 |
| 15 | Ga0160433_100384 | 3300012846 | Unclassified | 24917 |
| 16 | Ga0160445_100536 | 3300012847 | Bacteria | 17766 |
| 17 | Ga0316159_10001 | 3300030930 | Bacteria | 1642808 |
| 18 | Ga0466725_436653 | 3300042654 | Bacteria | 5842 |
| 19 | Ga0466707_348963 | 3300042601 | Bacteria | 3897 |
| 20 | Ga0466713_102643 | 3300042602 | Bacteria | 7951 |
| 21 | IMNBL1DRAFT_c0004770 | 3300000062 | Bacteria | 8009 |
| 22 | Ga0102740_1003012 | 3300007140 | Bacteria | 3704 |
| 23 | Ga0104019_1000770 | 3300007150 | Unclassified | 16161 |
| 24 | Ga0104050_1005622 | 3300007153 | Unclassified | 17389 |
| 25 | Ga0466715_612489 | 3300042616 | Bacteria | 1808 |
| 26 | Ga0160445_100818 | 3300012847 | Bacteria | 11526 |
| 27 | Ga0160443_108040 | 3300012848 | Bacteria | 1282 |
| 28 | Ga0160448_100008 | 3300012854 | Unclassified | 336728 |
| 29 | Ga0160457_1001732 | 3300012858 | Unclassified | 5508 |
| 30 | Ga0466729_270518 | 3300042621 | Bacteria | 2683 |
| 31 | Ga0466703_189308 | 3300042636 | Bacteria | 4994 |
| 32 | Ga0466713_033492 | 3300042602 | Bacteria | 93098 |
| 33 | Ga0466722_066910 | 3300042609 | Unclassified | 1699 |
| 34 | Ga0102736_1001693 | 3300007052 | Bacteria | 3752 |
| 35 | Ga0104050_1000520 | 3300007153 | Bacteria | 4633 |
| 36 | Ga0466711_400401 | 3300042615 | Bacteria | 7033 |
| 37 | Ga0466715_323892 | 3300042616 | Bacteria | 8775 |
| 38 | Ga0466729_039845 | 3300042621 | Bacteria | 14522 |
| 39 | Ga0160453_100551 | 3300012814 | Unclassified | 26483 |
| 40 | Ga0160467_100445 | 3300012829 | Bacteria | 40999 |
| 41 | Ga0160459_106696 | 3300012831 | Bacteria | 1468 |
| 42 | Ga0160447_104228 | 3300012849 | Bacteria | 4319 |
| 43 | Ga0466691_130499 | 3300042593 | Bacteria | 13435 |
| 44 | Ga0466709_133004 | 3300042648 | Bacteria | 188114 |
| 45 | Ga0466724_61835 | 3300042649 | Bacteria | 39158 |
| 46 | Ga0160466_100062 | 3300012809 | Bacteria | 126237 |
| 47 | Meta3P_1000043 | 3300002464 | Bacteria | 71817 |
| 48 | CVPL005W_1000905 | 3300002934 | Bacteria | 9522 |
| 49 | Ga0103264_1000505 | 3300007188 | Bacteria | 19921 |
| 50 | Ga0466711_080735 | 3300042615 | Bacteria | 1374 |
| 51 | Ga0466711_099625 | 3300042615 | Bacteria | 26383 |
| 52 | Ga0466711_284903 | 3300042615 | Bacteria | 10999 |
| 53 | Ga0466715_119065 | 3300042616 | Bacteria | 1597 |
| 54 | Ga0466715_441291 | 3300042616 | Bacteria | 25941 |
| 55 | Ga0466715_492111 | 3300042616 | Bacteria | 4125 |
| 56 | Ga0466705_048611 | 3300042612 | Bacteria | 2172 |
| 57 | Ga0160453_100040 | 3300012814 | Bacteria | 158320 |
| 58 | Ga0160432_100022 | 3300012818 | Bacteria | 275704 |
| 59 | Ga0160447_100031 | 3300012849 | Bacteria | 208699 |
| 60 | Ga0160447_104748 | 3300012849 | Bacteria | 3941 |
| 61 | Ga0160430_101735 | 3300012852 | Bacteria | 7685 |
| 62 | Ga0466691_010774 | 3300042593 | Bacteria | 2742 |
| 63 | Ga0466729_308401 | 3300042621 | Bacteria | 1273 |
| 64 | Ga0466708_116460 | 3300042652 | Bacteria | 6459 |
| 65 | Ga0466700_111634 | 3300042600 | Bacteria | 2247 |
| 66 | Ga0466713_100528 | 3300042602 | Bacteria | 510720 |
| 67 | Ga0466716_496101 | 3300042605 | Bacteria | 7114 |
| 68 | Ga0466719_151560 | 3300042606 | Bacteria | 7102 |
| 69 | DPOL_contig20210 | 2035918003 | Bacteria | 53501 |
| 70 | Ga0102735_1000262 | 3300007080 | Unclassified | 16310 |
| 71 | Ga0104045_1018450 | 3300007085 | Bacteria | 5110 |
| 72 | Ga0102739_1001194 | 3300007095 | Bacteria | 4388 |
| 73 | Ga0466711_192531 | 3300042615 | Bacteria | 6314 |
| 74 | Ga0466711_406702 | 3300042615 | Bacteria | 3712 |
| 75 | Ga0466711_477835 | 3300042615 | Bacteria | 3059 |
| 76 | Ga0466715_119004 | 3300042616 | Bacteria | 2673 |
| 77 | Ga0466715_256510 | 3300042616 | Bacteria | 2695 |
| 78 | Ga0466726_087234 | 3300042619 | Bacteria | 1891 |
| 79 | Ga0160453_100011 | 3300012814 | Bacteria | 295926 |
| 80 | Ga0160441_100173 | 3300012825 | Bacteria | 70327 |
| 81 | Ga0160467_100054 | 3300012829 | Bacteria | 169206 |
| 82 | Ga0160446_100018 | 3300012835 | Bacteria | 242201 |
| 83 | Ga0160445_100039 | 3300012847 | Bacteria | 164891 |
| 84 | Ga0160443_103075 | 3300012848 | Bacteria | 3136 |
| 85 | Ga0160434_100217 | 3300012850 | Bacteria | 26409 |
| 86 | Ga0160435_1005400 | 3300012857 | Bacteria | 2899 |
| 87 | Ga0466724_40452 | 3300042649 | Bacteria | 47603 |
| 88 | JGI24698J34947_10031341 | 3300002449 | Archaea | 2799 |
| 89 | Ga0104019_1001793 | 3300007150 | Bacteria | 2925 |
| 90 | Ga0466711_200938 | 3300042615 | Bacteria | 4343 |
| 91 | Ga0466711_514205 | 3300042615 | Bacteria | 3190 |
| 92 | Ga0466715_334520 | 3300042616 | Bacteria | 5441 |
| 93 | Ga0466723_093681 | 3300042618 | Bacteria | 4854 |
| 94 | Ga0160447_101527 | 3300012849 | Bacteria | 8930 |
| 95 | Ga0265387_1000062 | 3300024582 | Bacteria | 33660 |
| 96 | Ga0466656_320484 | 3300042550 | Bacteria | 2543 |
| 97 | Ga0466690_055692 | 3300042590 | Bacteria | 2129 |
| 98 | Ga0466690_311136 | 3300042590 | Bacteria | 5324 |
| 99 | Ga0466703_180221 | 3300042636 | Bacteria | 11765 |
| 100 | Ga0466709_244883 | 3300042648 | Bacteria | 1308 |
| 101 | Ga0466709_279049 | 3300042648 | Bacteria | 4105 |
| 102 | Ga0466722_126837 | 3300042609 | Bacteria | 2538 |
| 103 | Meta3P_1002960 | 3300002464 | Unclassified | 6481 |
| 104 | Ga0103260_1001360 | 3300007139 | Bacteria | 4411 |
| 105 | Ga0104050_1000136 | 3300007153 | Bacteria | 6824 |
| 106 | Ga0104050_1001340 | 3300007153 | Bacteria | 2187 |
| 107 | Ga0466715_467199 | 3300042616 | Bacteria | 2718 |
| 108 | Ga0466723_170548 | 3300042618 | Bacteria | 5741 |
| 109 | Ga0466728_148666 | 3300042620 | Bacteria | 13542 |
| 110 | Ga0466733_044548 | 3300042659 | Bacteria | 4007 |
| 111 | Ga0160431_100002 | 3300012828 | Bacteria | 521722 |
| 112 | Ga0160472_103041 | 3300012839 | Bacteria | 3487 |
| 113 | Ga0160433_100016 | 3300012846 | Bacteria | 218010 |
| 114 | Ga0160443_100041 | 3300012848 | Bacteria | 309778 |
| 115 | Ga0466656_054032 | 3300042550 | Bacteria | 5906 |
| 116 | Ga0466709_178426 | 3300042648 | Bacteria | 1428 |
| 117 | Ga0160464_100009 | 3300012805 | Bacteria | 325341 |
| 118 | Ga0466713_029419 | 3300042602 | Bacteria | 3503 |
| 119 | Ga0103261_1000988 | 3300007083 | Bacteria | 4441 |
| 120 | Ga0104048_1022297 | 3300007143 | Bacteria | 5092 |
| 121 | Ga0466712_030131 | 3300042614 | Bacteria | 2046 |
| 122 | Ga0466711_031297 | 3300042615 | Bacteria | 2820 |
| 123 | Ga0466715_204289 | 3300042616 | Bacteria | 4203 |
| 124 | Ga0466723_190017 | 3300042618 | Bacteria | 5808 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF12697 | Abhydrolase_6 | Alpha/beta hydrolase family | 108 | 324 | 0.58 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.