Protein Family IF06428
Metagenome
Metatranscriptome
Isolate
492
Members
164
Samples
396
Scaffolds
180.94
Avg Length
Representative Sequence
- ID
- 3300042605|Ga0466716_495889|Ga0466716_495889_724_1335
- Length
- 203 aa
- Sequence
- VNLRLAEKYCATFINLGGKKMSRIGKLPIQVPTGVTVTVNDHVVAVKGPKGELTQNVNPDIKISLENGVLQLTRISNERNHRAMHGLYRSLINNMVIGVSTGYKKEMELVGVGYRVTNTGQLIDLSLGYTHNIYIQLPAEVKVETKTERNKNPLIILESADKQLIGQVCAKIRSFRMPEPYKGKGIKFVGEVVRRKSGKSAGK
Sample Types
Isolate
19.5%
Metagenome
80.3%
MAG
0.0%
Metatranscriptome
0.2%
Single Cell
0.0%
Taxa Family Distribution
Blattidae
23.4%
Termitidae
19.0%
Unclassified
16.5%
Kalotermitidae
8.9%
Cryptocercidae
7.6%
Rhinotermitidae
4.4%
Blaberidae
2.5%
Termopsidae
2.5%
Pseudophyllodromiidae
1.9%
Passalidae
1.9%
Corydiidae
1.9%
Blattellidae
1.3%
Formicidae
1.3%
Hydrophilidae
1.3%
Aphididae
0.6%
Tryonicidae
0.6%
Hodotermitidae
0.6%
Monophlebidae
0.6%
Armadillidiidae
0.6%
Tenebrionidae
0.6%
Diaspididae
0.6%
Ectobiidae
0.6%
Nyctiboridae
0.6%
Taxonomy
Archaea
0
Bacteria
481
Eukaryota
0
Viruses
0
Unclassified
11
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2609459943 | Bacteroides reticulotermitis JCM 10512 | Isolate | Rhinotermitidae |
| 2 | 2695420314 | Dysgonomonas sp. BGC7 | Isolate | Unclassified |
| 3 | 2820364642 | Unclassified Firmicutes Nt197P3bin107 | Isolate | Unclassified |
| 4 | 2820741847 | Unclassified Bacteroidetes Th196P3bin71 | Isolate | Unclassified |
| 5 | 2791354848 | Unclassified Chloroflexi Emb289P3bin155 | Isolate | Unclassified |
| 6 | 2820776227 | Unclassified Bacteroidetes Emb289P4bin3 | Isolate | Unclassified |
| 7 | 2833033236 | Blattabacterium sp. CKYod | Isolate | Cryptocercidae |
| 8 | 2833047020 | Blattabacterium punctulatus CPUbt | Isolate | Cryptocercidae |
| 9 | 2833050843 | Blattabacterium punctulatus CPUmc | Isolate | Cryptocercidae |
| 10 | 3002027480 | Blattabacterium cuenoti SCHULTlam | Isolate | Unclassified |
| 11 | 3002031819 | Blattabacterium cuenoti SHELFORDIsp | Isolate | Pseudophyllodromiidae |
| 12 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 13 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 14 | 3300012834 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG | Metagenome | |
| 15 | 3300021235 | Termite gut microbial communities from nest from French Guiana - FG16_2_6 mRNA SA | Metatranscriptome | |
| 16 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 17 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 18 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 19 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 20 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 21 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 22 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 23 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 24 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 25 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 26 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 27 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 28 | 2695420931 | Dysgonomonas macrotermitis DSM 27370 | Isolate | Unclassified |
| 29 | 2820327087 | Unclassified Firmicutes Nt197P3bin79 | Isolate | Unclassified |
| 30 | 2820762746 | Unclassified Bacteroidetes Mp193P4bin3 | Isolate | Unclassified |
| 31 | 2940205530 | Parabacteroides sp. PH5-33 | Isolate | Blattidae |
| 32 | 2940216256 | Dysgonomonadaceae bacterium PH5-43 | Isolate | Blattidae |
| 33 | 2940317558 | Parabacteroides sp. PH5-26 | Isolate | Blattidae |
| 34 | 2940325180 | Parabacteroides sp. PH5-41 | Isolate | Blattidae |
| 35 | 2998929858 | Bacteroidetes endosymbiont of Geopemphigus sp. GspS2-BC2016 | Isolate | Aphididae |
| 36 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 37 | 3300012809 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E11 MG | Metagenome | |
| 38 | 2225789003 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) | Metagenome | Passalidae |
| 39 | 2820014844 | Unclassified Spirochaetes Nt197P3bin95 | Isolate | Unclassified |
| 40 | 2820765201 | Unclassified Bacteroidetes Lab288P3bin82 | Isolate | Unclassified |
| 41 | 2820778767 | Unclassified Bacteroidetes Emb289P4bin10 | Isolate | Unclassified |
| 42 | 2830041218 | Bacteroides reticulotermitis DSM 105720 | Isolate | Unclassified |
| 43 | 2833043393 | Blattabacterium clevelandi CCLhc | Isolate | Cryptocercidae |
| 44 | 2910930387 | Dysgonomonas sp. 216 | Isolate | Blattidae |
| 45 | 2910942425 | Dysgonomonas sp. 521 | Isolate | Blattidae |
| 46 | 2940212447 | Parabacteroides sp. PH5-16 | Isolate | Blattidae |
| 47 | 2940244548 | Dysgonomonas sp. PF1-14 | Isolate | Blattidae |
| 48 | 2940302308 | Parabacteroides sp. PF5-5 | Isolate | Blattidae |
| 49 | 2940321370 | Parabacteroides sp. PH5-39 | Isolate | Blattidae |
| 50 | 2940332795 | Parabacteroides sp. PH5-8 | Isolate | Blattidae |
| 51 | 3002008998 | Blattabacterium cuenoti PARCOBvir | Isolate | Blattellidae |
| 52 | 3002022645 | Blattabacterium cuenoti TRYONIpar | Isolate | Tryonicidae |
| 53 | 3002029927 | Blattabacterium cuenoti CHORISOsp | Isolate | Pseudophyllodromiidae |
| 54 | 3002031185 | Blattabacterium cuenoti OPISTHori | Isolate | Blaberidae |
| 55 | 3004672520 | Bacteroides sp. 51 | Isolate | Blattidae |
| 56 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 57 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 58 | 643348524 | Candidatus Azobacteroides pseudotrichonymphae gv. CFP2 | Isolate | Unclassified |
| 59 | 8100166142 | Dysgonomonas sp. GY75 | Isolate | Rhinotermitidae |
| 60 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 61 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 62 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 63 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 64 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 65 | 2695420317 | Dysgonomonas sp. HGC4 | Isolate | Unclassified |
| 66 | 2833037493 | Blattabacterium punctulatus CPUsv | Isolate | Cryptocercidae |
| 67 | 2833042786 | Blattabacterium punctulatus CPUsm | Isolate | Cryptocercidae |
| 68 | 2833051446 | Blattabacterium punctulatus CPUml | Isolate | Cryptocercidae |
| 69 | 2922326829 | Bacteroides sp. 224 | Isolate | Blattidae |
| 70 | 2940253009 | Dysgonomonas sp. PF1-23 | Isolate | Blattidae |
| 71 | 2940257232 | Dysgonomonas sp. PFB1-18 | Isolate | Blattidae |
| 72 | 2940313741 | Parabacteroides sp. PH5-17 | Isolate | Blattidae |
| 73 | 3002004002 | Blattabacterium cuenoti EUPOLsin | Isolate | Corydiidae |
| 74 | 3002032411 | Blattabacterium cuenoti POLYPHAGsp | Isolate | Corydiidae |
| 75 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 76 | 3300007188 | Ant gut microbial communities from Cephalotes rohweri, Arizona, USA | Metagenome | Formicidae |
| 77 | 3300009460 | Microbial communities of aphids from Pistacia texana in Langtry, TX, USA - Geopemphigus sp. seqcov | Metagenome | |
| 78 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 79 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 80 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 81 | 2820010479 | Unclassified Spirochaetes Th196P4bin55 | Isolate | Unclassified |
| 82 | 2820350530 | Unclassified Firmicutes Nt197P3bin37 | Isolate | Unclassified |
| 83 | 2820757377 | Unclassified Bacteroidetes Mp193P4bin6 | Isolate | Unclassified |
| 84 | 2833034481 | Blattabacterium punctulatus CPUwf | Isolate | Cryptocercidae |
| 85 | 2873610414 | Dysgonomonas sp. HDW5B | Isolate | Hydrophilidae |
| 86 | 2940199050 | Parabacteroides sp. PM6-13 | Isolate | Blattidae |
| 87 | 2940202316 | Parabacteroides sp. PF5-9 | Isolate | Blattidae |
| 88 | 2940371297 | Parabacteroides sp. PM5-20 | Isolate | Blattidae |
| 89 | 2967483437 | Candidatus Ordinivivax streblomastigis St1 | Isolate | Unclassified |
| 90 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 91 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 92 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 93 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 94 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 95 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 96 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 97 | 646311912 | Blattabacterium sp. BPLAN | Isolate | Blattidae |
| 98 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 99 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 100 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 101 | 2820759988 | Unclassified Bacteroidetes Mp193P4bin4 | Isolate | Unclassified |
| 102 | 2833030225 | Blattabacterium punctulatus CPUmp | Isolate | Cryptocercidae |
| 103 | 2910949487 | Dysgonomonas sp. 520 | Isolate | Blattidae |
| 104 | 2910959314 | Dysgonomonas sp. 511 | Isolate | Blattidae |
| 105 | 2923982719 | Parabacteroides sp. 52 | Isolate | Blattidae |
| 106 | 2940306115 | Parabacteroides sp. PFB2-22 | Isolate | Blattidae |
| 107 | 2940309933 | Parabacteroides sp. PH5-13 | Isolate | Blattidae |
| 108 | 2940328985 | Parabacteroides sp. PH5-46 | Isolate | Blattidae |
| 109 | 3002024525 | Blattabacterium cuenoti EPILAmay | Isolate | Blaberidae |
| 110 | 3002025727 | Blattabacterium cuenoti EUPHYsp | Isolate | Pseudophyllodromiidae |
| 111 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 112 | 3300007052 | Ant gut microbial communities from Cephalotes eduarduli, Brazil | Metagenome | Formicidae |
| 113 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 114 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 115 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 116 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 117 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 118 | 8100157865 | Dysgonomonas sp. GY617 | Isolate | Rhinotermitidae |
| 119 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 120 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 121 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 122 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 123 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 124 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 125 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 126 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 127 | 2819998259 | Unclassified Spirochaetes Nc150P4bin23 | Isolate | Unclassified |
| 128 | 2511231112 | Blattabacterium punctulatus Cpu | Isolate | Cryptocercidae |
| 129 | 2585427656 | Endosymbiont of Llaveia axin axin | Isolate | Monophlebidae |
| 130 | 2833044002 | Blattabacterium punctulatus CPUbr | Isolate | Cryptocercidae |
| 131 | 2873600114 | Dysgonomonas sp. HDW5A | Isolate | Hydrophilidae |
| 132 | 2940193328 | Dysgonomonas sp. PH5-45 | Isolate | Blattidae |
| 133 | 2940248789 | Dysgonomonas sp. PF1-16 | Isolate | Blattidae |
| 134 | 2940346213 | Parabacteroides sp. PFB2-12 | Isolate | Blattidae |
| 135 | 3002003370 | Blattabacterium cuenoti THEREAreg | Isolate | Corydiidae |
| 136 | 3002005207 | Blattabacterium cuenoti MELANOZsp | Isolate | Blattidae |
| 137 | 3002023256 | Blattabacterium cuenoti RHABDOBsp | Isolate | Blaberidae |
| 138 | 3002028747 | Blattabacterium cuenoti ESCALves | Isolate | Blattellidae |
| 139 | 3002030550 | Blattabacterium cuenoti NEOLAXmac | Isolate | Blaberidae |
| 140 | 3004677695 | Bacteroides sp. 214 | Isolate | Blattidae |
| 141 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 142 | 3300012848 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG | Metagenome | Armadillidiidae |
| 143 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 144 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 145 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 146 | 2781125686 | Treponema sp. Lab288P4bin22 | Isolate | Unclassified |
| 147 | 2540341063 | Candidatus Uzinura diaspidicola ASNER | Isolate | Diaspididae |
| 148 | 2561511170 | Blattabacterium sp. (Blatta orientalis) Tarazona | Isolate | Unclassified |
| 149 | 2833033875 | Blattabacterium punctulatus CPUpc | Isolate | Cryptocercidae |
| 150 | 2910926975 | Dysgonomonas sp. 25 | Isolate | Blattidae |
| 151 | 2940195863 | Parabacteroides sp. PF5-6 | Isolate | Blattidae |
| 152 | 2940209341 | Parabacteroides sp. PFB2-10 | Isolate | Blattidae |
| 153 | 2940298504 | Parabacteroides sp. PF5-13 | Isolate | Blattidae |
| 154 | 2940336608 | Dysgonomonas sp. PH5-37 | Isolate | Blattidae |
| 155 | 3002005847 | Blattabacterium cuenoti ECTOBIsp | Isolate | Ectobiidae |
| 156 | 3002023891 | Blattabacterium cuenoti MEGALOsp | Isolate | Nyctiboridae |
| 157 | 3004667792 | Bacteroides sp. 519 | Isolate | Blattidae |
| 158 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 159 | 3300012814 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E6 MG | Metagenome | |
| 160 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 161 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 162 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 163 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 164 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466697_070360 | 3300042611 | Bacteria | 1335 |
| 2 | Ga0466705_375741 | 3300042612 | Bacteria | 24449 |
| 3 | Ga0466732_250789 | 3300042656 | Bacteria | 4406 |
| 4 | Ga0466733_052339 | 3300042659 | Bacteria | 35317 |
| 5 | Ga0466733_197911 | 3300042659 | Bacteria | 1964 |
| 6 | Ga0466705_467272 | 3300042612 | Bacteria | 3155 |
| 7 | Ga0466711_011252 | 3300042615 | Bacteria | 11053 |
| 8 | Ga0466711_189861 | 3300042615 | Bacteria | 40824 |
| 9 | Ga0466715_045203 | 3300042616 | Bacteria | 21834 |
| 10 | Ga0466715_170049 | 3300042616 | Bacteria | 1513 |
| 11 | Ga0466728_012515 | 3300042620 | Bacteria | 24746 |
| 12 | Ga0466728_018673 | 3300042620 | Bacteria | 22808 |
| 13 | Ga0123357_10040344 | 3300009784 | Bacteria | 6346 |
| 14 | Ga0123353_10003757 | 3300010167 | Bacteria | 19326 |
| 15 | Ga0123353_10016319 | 3300010167 | Bacteria | 10850 |
| 16 | Ga0123354_10153694 | 3300010882 | Bacteria | 2773 |
| 17 | Ga0466701_076335 | 3300042598 | Bacteria | 60822 |
| 18 | Ga0466707_323089 | 3300042601 | Bacteria | 1802 |
| 19 | Ga0466713_138569 | 3300042602 | Bacteria | 2005 |
| 20 | Ga0466717_311909 | 3300042604 | Bacteria | 3123 |
| 21 | Ga0466716_453357 | 3300042605 | Bacteria | 4566 |
| 22 | Ga0466716_501317 | 3300042605 | Bacteria | 2818 |
| 23 | Ga0466722_117304 | 3300042609 | Bacteria | 122884 |
| 24 | Ga0466692_188243 | 3300042591 | Bacteria | 86416 |
| 25 | Ga0466691_045847 | 3300042593 | Bacteria | 49393 |
| 26 | Ga0466696_079953 | 3300042596 | Bacteria | 4070 |
| 27 | Ga0466696_217431 | 3300042596 | Bacteria | 1826 |
| 28 | IMNBL1DRAFT_c0000355 | 3300000062 | Bacteria | 38787 |
| 29 | IMNBL1DRAFT_c0000682 | 3300000062 | Bacteria | 27226 |
| 30 | IMNBL1DRAFT_c0003219 | 3300000062 | Bacteria | 10674 |
| 31 | IMNBL1DRAFT_c0041101 | 3300000062 | Bacteria | 1557 |
| 32 | JGI24702J35022_10000437 | 3300002462 | Bacteria | 25160 |
| 33 | JGI24705J35276_12214525 | 3300002504 | Bacteria | 1965 |
| 34 | JGI24705J35276_12219018 | 3300002504 | Bacteria | 2179 |
| 35 | JGI24699J35502_11133946 | 3300002509 | Bacteria | 20622 |
| 36 | Ga0068305_10003312 | 3300005083 | Bacteria | 66359 |
| 37 | Ga0068305_10005585 | 3300005083 | Bacteria | 21211 |
| 38 | Ga0068305_10026156 | 3300005083 | Bacteria | 20761 |
| 39 | Ga0072941_1004548 | 3300005201 | Bacteria | 11815 |
| 40 | Ga0123357_10000278 | 3300009784 | Bacteria | 48976 |
| 41 | Ga0466734_007006 | 3300042623 | Bacteria | 1982 |
| 42 | Ga0466734_130976 | 3300042623 | Bacteria | 3519 |
| 43 | Ga0466735_014617 | 3300042624 | Bacteria | 1887 |
| 44 | Ga0466735_078473 | 3300042624 | Bacteria | 1166 |
| 45 | Ga0466735_087275 | 3300042624 | Bacteria | 8538 |
| 46 | Ga0466735_152196 | 3300042624 | Bacteria | 3972 |
| 47 | Ga0466735_212374 | 3300042624 | Bacteria | 8212 |
| 48 | Ga0466703_136221 | 3300042636 | Bacteria | 3334 |
| 49 | Ga0466704_017562 | 3300042643 | Unclassified | 1905 |
| 50 | Ga0466704_300588 | 3300042643 | Bacteria | 28806 |
| 51 | Ga0466704_541626 | 3300042643 | Bacteria | 3198 |
| 52 | Ga0466732_144223 | 3300042656 | Bacteria | 2440 |
| 53 | Ga0466732_238214 | 3300042656 | Bacteria | 1778 |
| 54 | Ga0466732_296537 | 3300042656 | Bacteria | 1670 |
| 55 | Ga0466733_028819 | 3300042659 | Bacteria | 27870 |
| 56 | Ga0466710_167173 | 3300042613 | Bacteria | 1123 |
| 57 | Ga0466715_044375 | 3300042616 | Bacteria | 14700 |
| 58 | Ga0466715_231188 | 3300042616 | Bacteria | 1518 |
| 59 | Ga0466723_123534 | 3300042618 | Bacteria | 8663 |
| 60 | Ga0466723_184116 | 3300042618 | Bacteria | 30069 |
| 61 | Ga0466726_064923 | 3300042619 | Bacteria | 35500 |
| 62 | Ga0466726_144476 | 3300042619 | Bacteria | 21004 |
| 63 | Ga0123356_10446596 | 3300010049 | Bacteria | 1440 |
| 64 | Ga0123354_10290766 | 3300010882 | Bacteria | 1567 |
| 65 | Ga0466707_125243 | 3300042601 | Bacteria | 1083 |
| 66 | Ga0466707_207725 | 3300042601 | Bacteria | 3855 |
| 67 | Ga0466713_026562 | 3300042602 | Bacteria | 15627 |
| 68 | Ga0466713_096596 | 3300042602 | Bacteria | 406546 |
| 69 | Ga0466713_113019 | 3300042602 | Bacteria | 16771 |
| 70 | Ga0466716_153890 | 3300042605 | Bacteria | 1539 |
| 71 | Ga0466719_292822 | 3300042606 | Bacteria | 42754 |
| 72 | Ga0466722_088834 | 3300042609 | Bacteria | 20099 |
| 73 | Ga0466722_143981 | 3300042609 | Bacteria | 20003 |
| 74 | Ga0466657_170561 | 3300042582 | Bacteria | 2575 |
| 75 | Ga0466690_136026 | 3300042590 | Bacteria | 11620 |
| 76 | Ga0466690_136616 | 3300042590 | Bacteria | 29160 |
| 77 | Ga0466690_142235 | 3300042590 | Bacteria | 1296 |
| 78 | Ga0466692_142563 | 3300042591 | Bacteria | 9391 |
| 79 | Ga0466692_161873 | 3300042591 | Bacteria | 51547 |
| 80 | Ga0466693_038881 | 3300042592 | Unclassified | 2549 |
| 81 | Ga0466694_385058 | 3300042594 | Bacteria | 6267 |
| 82 | Ga0466696_226790 | 3300042596 | Bacteria | 1911 |
| 83 | 2227196660 | 2225789004 | Bacteria | 1449 |
| 84 | IMNBL1DRAFT_c0021577 | 3300000062 | Bacteria | 2573 |
| 85 | JGI24702J35022_10026093 | 3300002462 | Bacteria | 3149 |
| 86 | JGI24702J35022_10028939 | 3300002462 | Bacteria | 2974 |
| 87 | Ga0068302_10075265 | 3300005071 | Bacteria | 3006 |
| 88 | Ga0068305_10010112 | 3300005083 | Bacteria | 17726 |
| 89 | Ga0068305_10858063 | 3300005083 | Bacteria | 1480 |
| 90 | Ga0127649_100060 | 3300009460 | Bacteria | 50841 |
| 91 | Ga0466734_023318 | 3300042623 | Bacteria | 1290 |
| 92 | Ga0466734_109792 | 3300042623 | Bacteria | 3945 |
| 93 | Ga0466735_071242 | 3300042624 | Bacteria | 4680 |
| 94 | Ga0466703_027519 | 3300042636 | Bacteria | 2324 |
| 95 | Ga0466703_109702 | 3300042636 | Bacteria | 21153 |
| 96 | Ga0466703_259701 | 3300042636 | Bacteria | 11196 |
| 97 | Ga0466703_279649 | 3300042636 | Bacteria | 29017 |
| 98 | Ga0466703_369160 | 3300042636 | Bacteria | 28465 |
| 99 | Ga0466703_394673 | 3300042636 | Bacteria | 1474 |
| 100 | Ga0466704_022207 | 3300042643 | Bacteria | 18398 |
| 101 | Ga0466704_095977 | 3300042643 | Bacteria | 7095 |
| 102 | Ga0466704_144964 | 3300042643 | Bacteria | 2321 |
| 103 | Ga0466704_391387 | 3300042643 | Bacteria | 2193 |
| 104 | Ga0466709_083357 | 3300042648 | Bacteria | 39489 |
| 105 | Ga0466709_118201 | 3300042648 | Bacteria | 25211 |
| 106 | Ga0466709_129005 | 3300042648 | Bacteria | 13583 |
| 107 | Ga0466708_143755 | 3300042652 | Bacteria | 8647 |
| 108 | Ga0466727_009300 | 3300042655 | Bacteria | 1757 |
| 109 | Ga0466727_175984 | 3300042655 | Bacteria | 3199 |
| 110 | Ga0466727_225049 | 3300042655 | Bacteria | 48864 |
| 111 | Ga0466727_231897 | 3300042655 | Bacteria | 4151 |
| 112 | Ga0466697_154104 | 3300042611 | Bacteria | 1450 |
| 113 | Ga0466697_212074 | 3300042611 | Bacteria | 3433 |
| 114 | Ga0466705_174916 | 3300042612 | Bacteria | 2546 |
| 115 | Ga0466705_350476 | 3300042612 | Bacteria | 1615 |
| 116 | Ga0466733_129685 | 3300042659 | Bacteria | 8007 |
| 117 | Ga0466733_220977 | 3300042659 | Bacteria | 23380 |
| 118 | Ga0562377_0004 | 3300056842 | Bacteria | 3525959 |
| 119 | Ga0466712_108760 | 3300042614 | Bacteria | 3257 |
| 120 | Ga0466715_154449 | 3300042616 | Bacteria | 23802 |
| 121 | Ga0466728_117468 | 3300042620 | Bacteria | 23405 |
| 122 | Ga0123357_10132820 | 3300009784 | Unclassified | 3091 |
| 123 | Ga0123356_10001427 | 3300010049 | Bacteria | 26432 |
| 124 | Ga0123356_10160906 | 3300010049 | Bacteria | 2242 |
| 125 | Ga0123356_10336779 | 3300010049 | Bacteria | 1628 |
| 126 | Ga0123356_10398377 | 3300010049 | Bacteria | 1514 |
| 127 | Ga0123353_11029034 | 3300010167 | Bacteria | 1103 |
| 128 | Ga0466706_126288 | 3300042599 | Bacteria | 17453 |
| 129 | Ga0466706_261195 | 3300042599 | Bacteria | 2955 |
| 130 | Ga0466707_275321 | 3300042601 | Bacteria | 2181 |
| 131 | Ga0466707_359731 | 3300042601 | Bacteria | 1903 |
| 132 | Ga0466717_073023 | 3300042604 | Bacteria | 5695 |
| 133 | Ga0466716_122468 | 3300042605 | Bacteria | 22074 |
| 134 | Ga0466722_207156 | 3300042609 | Bacteria | 3849 |
| 135 | Ga0466697_018248 | 3300042611 | Bacteria | 1420 |
| 136 | Ga0466657_122402 | 3300042582 | Bacteria | 2185 |
| 137 | Ga0466690_130793 | 3300042590 | Bacteria | 15221 |
| 138 | Ga0466690_212563 | 3300042590 | Bacteria | 2638 |
| 139 | Ga0466696_123857 | 3300042596 | Bacteria | 4366 |
| 140 | Ga0466696_201817 | 3300042596 | Bacteria | 41274 |
| 141 | 2227036519 | 2225789003 | Bacteria | 882 |
| 142 | IMNBL1DRAFT_c0000019 | 3300000062 | Bacteria | 170255 |
| 143 | IMNBL1DRAFT_c0002433 | 3300000062 | Bacteria | 12955 |
| 144 | JGI24702J35022_10004210 | 3300002462 | Bacteria | 8590 |
| 145 | Ga0103264_1000100 | 3300007188 | Bacteria | 49857 |
| 146 | Ga0466703_079639 | 3300042636 | Bacteria | 72500 |
| 147 | Ga0466703_105741 | 3300042636 | Bacteria | 30105 |
| 148 | Ga0466703_218555 | 3300042636 | Bacteria | 4756 |
| 149 | Ga0466703_374219 | 3300042636 | Bacteria | 24808 |
| 150 | Ga0466704_115291 | 3300042643 | Bacteria | 19465 |
| 151 | Ga0466708_014146 | 3300042652 | Bacteria | 33245 |
| 152 | Ga0466733_100891 | 3300042659 | Bacteria | 2452 |
| 153 | Ga0466710_376647 | 3300042613 | Bacteria | 1426 |
| 154 | Ga0466712_053087 | 3300042614 | Bacteria | 1959 |
| 155 | Ga0466711_025270 | 3300042615 | Bacteria | 4616 |
| 156 | Ga0466711_092510 | 3300042615 | Bacteria | 9915 |
| 157 | Ga0466711_212221 | 3300042615 | Bacteria | 10563 |
| 158 | Ga0466711_289238 | 3300042615 | Bacteria | 45865 |
| 159 | Ga0466715_434053 | 3300042616 | Bacteria | 17606 |
| 160 | Ga0466723_373256 | 3300042618 | Bacteria | 33738 |
| 161 | Ga0466726_462884 | 3300042619 | Bacteria | 2272 |
| 162 | Ga0466728_292510 | 3300042620 | Bacteria | 40918 |
| 163 | Ga0123353_10273613 | 3300010167 | Bacteria | 2600 |
| 164 | Ga0160466_100074 | 3300012809 | Bacteria | 108538 |
| 165 | Ga0466701_098566 | 3300042598 | Bacteria | 20155 |
| 166 | Ga0466706_206977 | 3300042599 | Bacteria | 1438 |
| 167 | Ga0466706_266807 | 3300042599 | Bacteria | 4506 |
| 168 | Ga0466707_217817 | 3300042601 | Bacteria | 5144 |
| 169 | Ga0466707_398960 | 3300042601 | Bacteria | 15809 |
| 170 | Ga0466713_137499 | 3300042602 | Bacteria | 46639 |
| 171 | Ga0466720_136351 | 3300042607 | Bacteria | 2550 |
| 172 | Ga0466698_390861 | 3300042610 | Bacteria | 2415 |
| 173 | Ga0160443_100387 | 3300012848 | Bacteria | 36918 |
| 174 | Ga0466693_094869 | 3300042592 | Bacteria | 1440 |
| 175 | Ga0466695_027666 | 3300042595 | Bacteria | 2720 |
| 176 | Ga0466696_479576 | 3300042596 | Bacteria | 3153 |
| 177 | 2227527393 | 2225789004 | Bacteria | 16791 |
| 178 | IMNBL1DRAFT_c0003005 | 3300000062 | Bacteria | 11178 |
| 179 | IMNBL1DRAFT_c0003450 | 3300000062 | Bacteria | 10155 |
| 180 | JGI24705J35276_12234599 | 3300002504 | Bacteria | 5658 |
| 181 | Ga0068305_10015112 | 3300005083 | Bacteria | 28238 |
| 182 | Ga0068305_10070669 | 3300005083 | Bacteria | 22554 |
| 183 | Ga0466734_016872 | 3300042623 | Bacteria | 1049 |
| 184 | Ga0466735_008034 | 3300042624 | Bacteria | 5195 |
| 185 | Ga0466703_229845 | 3300042636 | Bacteria | 1477 |
| 186 | Ga0466703_249699 | 3300042636 | Bacteria | 47455 |
| 187 | Ga0466703_315034 | 3300042636 | Bacteria | 2648 |
| 188 | Ga0466704_064085 | 3300042643 | Bacteria | 388657 |
| 189 | Ga0466704_277590 | 3300042643 | Unclassified | 1144 |
| 190 | Ga0466704_533188 | 3300042643 | Bacteria | 20326 |
| 191 | Ga0466697_212965 | 3300042611 | Bacteria | 1223 |
| 192 | Ga0466697_278661 | 3300042611 | Bacteria | 4280 |
| 193 | Ga0466705_019476 | 3300042612 | Bacteria | 24974 |
| 194 | Ga0466727_352642 | 3300042655 | Bacteria | 45291 |
| 195 | Ga0466733_106276 | 3300042659 | Bacteria | 6603 |
| 196 | Ga0466710_171760 | 3300042613 | Bacteria | 2195 |
| 197 | Ga0466710_448518 | 3300042613 | Bacteria | 2697 |
| 198 | Ga0466711_030146 | 3300042615 | Bacteria | 6235 |
| 199 | Ga0466723_058528 | 3300042618 | Bacteria | 28595 |
| 200 | Ga0466723_365995 | 3300042618 | Bacteria | 8488 |
| 201 | Ga0466729_056072 | 3300042621 | Bacteria | 21161 |
| 202 | Ga0466729_092833 | 3300042621 | Bacteria | 1688 |
| 203 | Ga0123356_10041702 | 3300010049 | Bacteria | 4277 |
| 204 | Ga0123353_10640184 | 3300010167 | Bacteria | 1508 |
| 205 | Ga0466706_067758 | 3300042599 | Bacteria | 37640 |
| 206 | Ga0466706_163745 | 3300042599 | Bacteria | 2067 |
| 207 | Ga0466706_177219 | 3300042599 | Bacteria | 25525 |
| 208 | Ga0466706_264266 | 3300042599 | Bacteria | 6035 |
| 209 | Ga0466707_335660 | 3300042601 | Bacteria | 1147 |
| 210 | Ga0466713_022772 | 3300042602 | Bacteria | 15388 |
| 211 | Ga0466714_059082 | 3300042603 | Bacteria | 46712 |
| 212 | Ga0466714_096666 | 3300042603 | Bacteria | 172614 |
| 213 | Ga0466716_495889 | 3300042605 | Bacteria | 3680 |
| 214 | Ga0466719_246678 | 3300042606 | Bacteria | 8577 |
| 215 | Ga0466722_078357 | 3300042609 | Bacteria | 10535 |
| 216 | Ga0466722_150186 | 3300042609 | Bacteria | 36176 |
| 217 | Ga0466697_006430 | 3300042611 | Bacteria | 1016 |
| 218 | Ga0223674_1019614 | 3300021235 | Bacteria | 724 |
| 219 | Ga0456237_0000012 | 3300041968 | Bacteria | 42362 |
| 220 | Ga0466656_127609 | 3300042550 | Bacteria | 23908 |
| 221 | Ga0466692_034023 | 3300042591 | Bacteria | 35790 |
| 222 | Ga0466693_033787 | 3300042592 | Bacteria | 2571 |
| 223 | Ga0466693_175010 | 3300042592 | Bacteria | 10069 |
| 224 | Ga0466693_219635 | 3300042592 | Bacteria | 3760 |
| 225 | Ga0466691_204814 | 3300042593 | Bacteria | 23707 |
| 226 | IMNBL1DRAFT_c0003207 | 3300000062 | Bacteria | 10697 |
| 227 | JGI24705J35276_12229214 | 3300002504 | Bacteria | 3345 |
| 228 | JGI24696J40584_12952346 | 3300002834 | Bacteria | 2336 |
| 229 | Ga0068302_10254197 | 3300005071 | Bacteria | 887 |
| 230 | Ga0466731_050866 | 3300042622 | Bacteria | 13115 |
| 231 | Ga0466734_050001 | 3300042623 | Bacteria | 1440 |
| 232 | Ga0466735_064263 | 3300042624 | Bacteria | 2824 |
| 233 | Ga0466735_177951 | 3300042624 | Bacteria | 10162 |
| 234 | Ga0466703_417292 | 3300042636 | Bacteria | 5033 |
| 235 | Ga0466704_410476 | 3300042643 | Bacteria | 1952 |
| 236 | Ga0466704_472759 | 3300042643 | Bacteria | 20123 |
| 237 | Ga0466704_552057 | 3300042643 | Bacteria | 6449 |
| 238 | Ga0466704_619871 | 3300042643 | Bacteria | 22946 |
| 239 | Ga0466708_151415 | 3300042652 | Unclassified | 1016 |
| 240 | Ga0466733_003112 | 3300042659 | Bacteria | 1304 |
| 241 | Ga0466712_194410 | 3300042614 | Bacteria | 3887 |
| 242 | Ga0466711_228133 | 3300042615 | Bacteria | 7712 |
| 243 | Ga0466715_119604 | 3300042616 | Bacteria | 22555 |
| 244 | Ga0466723_319654 | 3300042618 | Bacteria | 1705 |
| 245 | Ga0466726_202912 | 3300042619 | Bacteria | 1627 |
| 246 | Ga0466728_046729 | 3300042620 | Bacteria | 48709 |
| 247 | Ga0123356_10116584 | 3300010049 | Bacteria | 2590 |
| 248 | Ga0123353_11641987 | 3300010167 | Bacteria | 809 |
| 249 | Ga0123354_10618519 | 3300010882 | Bacteria | 786 |
| 250 | Ga0466701_053715 | 3300042598 | Unclassified | 2100 |
| 251 | Ga0466700_227706 | 3300042600 | Bacteria | 7006 |
| 252 | Ga0466700_405093 | 3300042600 | Bacteria | 5125 |
| 253 | Ga0466700_443434 | 3300042600 | Bacteria | 2047 |
| 254 | Ga0466707_157624 | 3300042601 | Bacteria | 13208 |
| 255 | Ga0466707_190959 | 3300042601 | Bacteria | 10157 |
| 256 | Ga0466713_017440 | 3300042602 | Bacteria | 108493 |
| 257 | Ga0466713_072740 | 3300042602 | Bacteria | 29878 |
| 258 | Ga0466714_122639 | 3300042603 | Bacteria | 2835 |
| 259 | Ga0466714_157013 | 3300042603 | Bacteria | 1168 |
| 260 | Ga0466716_126809 | 3300042605 | Bacteria | 9806 |
| 261 | Ga0466716_187110 | 3300042605 | Unclassified | 1633 |
| 262 | Ga0466716_335360 | 3300042605 | Bacteria | 11224 |
| 263 | Ga0466719_085003 | 3300042606 | Bacteria | 8101 |
| 264 | Ga0160443_100370 | 3300012848 | Bacteria | 37848 |
| 265 | Ga0466690_148925 | 3300042590 | Bacteria | 1079 |
| 266 | Ga0466692_149579 | 3300042591 | Bacteria | 83669 |
| 267 | Ga0466692_150867 | 3300042591 | Bacteria | 2128 |
| 268 | Ga0466696_064664 | 3300042596 | Bacteria | 19517 |
| 269 | Ga0466699_152937 | 3300042597 | Bacteria | 2607 |
| 270 | 2227591299 | 2225789004 | Bacteria | 12952 |
| 271 | IMNBL1DRAFT_c0020845 | 3300000062 | Unclassified | 2638 |
| 272 | JGI24702J35022_10010247 | 3300002462 | Bacteria | 5246 |
| 273 | JGI24702J35022_10017422 | 3300002462 | Bacteria | 3926 |
| 274 | JGI24702J35022_10042166 | 3300002462 | Bacteria | 2431 |
| 275 | JGI24702J35022_10084919 | 3300002462 | Bacteria | 1719 |
| 276 | JGI24702J35022_10344096 | 3300002462 | Bacteria | 890 |
| 277 | JGI24696J40584_12960867 | 3300002834 | Bacteria | 8988 |
| 278 | Ga0068302_10117181 | 3300005071 | Unclassified | 2360 |
| 279 | Ga0068305_10007816 | 3300005083 | Unclassified | 2470 |
| 280 | Ga0466731_210616 | 3300042622 | Bacteria | 4918 |
| 281 | Ga0466735_017313 | 3300042624 | Bacteria | 6644 |
| 282 | Ga0466735_056333 | 3300042624 | Bacteria | 1107 |
| 283 | Ga0466735_086581 | 3300042624 | Bacteria | 1917 |
| 284 | Ga0466703_073446 | 3300042636 | Bacteria | 8423 |
| 285 | Ga0466703_174311 | 3300042636 | Bacteria | 11934 |
| 286 | Ga0466704_415186 | 3300042643 | Bacteria | 17633 |
| 287 | Ga0466709_223255 | 3300042648 | Bacteria | 9867 |
| 288 | Ga0466709_322962 | 3300042648 | Bacteria | 7809 |
| 289 | Ga0466724_41596 | 3300042649 | Bacteria | 3998 |
| 290 | Ga0466708_050057 | 3300042652 | Bacteria | 16124 |
| 291 | Ga0466708_169565 | 3300042652 | Bacteria | 34312 |
| 292 | Ga0466727_099262 | 3300042655 | Bacteria | 17474 |
| 293 | Ga0466727_298973 | 3300042655 | Bacteria | 9257 |
| 294 | Ga0466697_080266 | 3300042611 | Bacteria | 2820 |
| 295 | Ga0466705_089766 | 3300042612 | Bacteria | 11993 |
| 296 | Ga0466705_348997 | 3300042612 | Bacteria | 1707 |
| 297 | Ga0466727_349423 | 3300042655 | Bacteria | 30219 |
| 298 | Ga0466711_095236 | 3300042615 | Bacteria | 15743 |
| 299 | Ga0466711_120016 | 3300042615 | Bacteria | 45710 |
| 300 | Ga0466715_025469 | 3300042616 | Bacteria | 20577 |
| 301 | Ga0466715_153338 | 3300042616 | Bacteria | 101125 |
| 302 | Ga0466726_009698 | 3300042619 | Bacteria | 1811 |
| 303 | Ga0466726_024142 | 3300042619 | Bacteria | 22843 |
| 304 | Ga0466726_242160 | 3300042619 | Bacteria | 13880 |
| 305 | Ga0466728_139914 | 3300042620 | Bacteria | 13626 |
| 306 | Ga0466728_371680 | 3300042620 | Bacteria | 8915 |
| 307 | Ga0123356_11285388 | 3300010049 | Bacteria | 895 |
| 308 | Ga0123356_12199081 | 3300010049 | Bacteria | 689 |
| 309 | Ga0466706_237229 | 3300042599 | Bacteria | 5073 |
| 310 | Ga0466707_023918 | 3300042601 | Bacteria | 27371 |
| 311 | Ga0466707_035038 | 3300042601 | Bacteria | 5579 |
| 312 | Ga0466707_098650 | 3300042601 | Bacteria | 10173 |
| 313 | Ga0466713_021681 | 3300042602 | Bacteria | 1307 |
| 314 | Ga0466713_027800 | 3300042602 | Bacteria | 40167 |
| 315 | Ga0466713_029225 | 3300042602 | Bacteria | 54762 |
| 316 | Ga0466713_083156 | 3300042602 | Unclassified | 1291 |
| 317 | Ga0466714_010000 | 3300042603 | Bacteria | 1905 |
| 318 | Ga0466716_240704 | 3300042605 | Bacteria | 7499 |
| 319 | Ga0466720_223112 | 3300042607 | Bacteria | 2281 |
| 320 | Ga0466722_073972 | 3300042609 | Bacteria | 128406 |
| 321 | Ga0466722_127886 | 3300042609 | Bacteria | 6387 |
| 322 | Ga0160452_100338 | 3300012834 | Bacteria | 40348 |
| 323 | Ga0466657_187230 | 3300042582 | Bacteria | 2048 |
| 324 | Ga0466690_088011 | 3300042590 | Bacteria | 17371 |
| 325 | Ga0466690_248346 | 3300042590 | Bacteria | 4114 |
| 326 | Ga0466695_330687 | 3300042595 | Bacteria | 7524 |
| 327 | Ga0466696_090243 | 3300042596 | Bacteria | 10365 |
| 328 | Ga0466696_326056 | 3300042596 | Bacteria | 4113 |
| 329 | 2227144426 | 2225789004 | Bacteria | 1610 |
| 330 | 2227194703 | 2225789004 | Bacteria | 7845 |
| 331 | 2227517976 | 2225789004 | Bacteria | 3399 |
| 332 | IMNBL1DRAFT_c0000677 | 3300000062 | Bacteria | 27305 |
| 333 | IMNBL1DRAFT_c0006755 | 3300000062 | Bacteria | 6199 |
| 334 | IMNBL1DRAFT_c0012380 | 3300000062 | Bacteria | 3905 |
| 335 | IMNBL1DRAFT_c0023075 | 3300000062 | Bacteria | 2446 |
| 336 | JGI24698J34947_10005068 | 3300002449 | Bacteria | 7215 |
| 337 | JGI24698J34947_10009875 | 3300002449 | Bacteria | 5232 |
| 338 | JGI24702J35022_10029452 | 3300002462 | Bacteria | 2947 |
| 339 | Ga0102736_1000046 | 3300007052 | Bacteria | 35527 |
| 340 | Ga0466731_135088 | 3300042622 | Bacteria | 1220 |
| 341 | Ga0466735_080555 | 3300042624 | Bacteria | 12371 |
| 342 | Ga0466735_199067 | 3300042624 | Bacteria | 3377 |
| 343 | Ga0466735_202234 | 3300042624 | Bacteria | 1838 |
| 344 | Ga0466703_246687 | 3300042636 | Bacteria | 2071 |
| 345 | Ga0466704_469392 | 3300042643 | Bacteria | 2729 |
| 346 | Ga0466708_011558 | 3300042652 | Bacteria | 5438 |
| 347 | Ga0466708_254314 | 3300042652 | Bacteria | 24323 |
| 348 | Ga0466725_037990 | 3300042654 | Bacteria | 18222 |
| 349 | Ga0466725_427112 | 3300042654 | Bacteria | 8748 |
| 350 | Ga0466727_239203 | 3300042655 | Bacteria | 1255 |
| 351 | Ga0466697_149135 | 3300042611 | Bacteria | 3708 |
| 352 | Ga0466697_200641 | 3300042611 | Bacteria | 3343 |
| 353 | Ga0466733_221527 | 3300042659 | Bacteria | 2376 |
| 354 | Ga0466711_050658 | 3300042615 | Bacteria | 24311 |
| 355 | Ga0466711_161974 | 3300042615 | Bacteria | 1402 |
| 356 | Ga0466715_008870 | 3300042616 | Bacteria | 9655 |
| 357 | Ga0466715_265725 | 3300042616 | Bacteria | 12007 |
| 358 | Ga0466715_413291 | 3300042616 | Bacteria | 16037 |
| 359 | Ga0466715_586714 | 3300042616 | Bacteria | 57830 |
| 360 | Ga0466726_361642 | 3300042619 | Bacteria | 6372 |
| 361 | Ga0466726_494833 | 3300042619 | Bacteria | 4829 |
| 362 | Ga0466728_069680 | 3300042620 | Bacteria | 49538 |
| 363 | Ga0123356_11031169 | 3300010049 | Bacteria | 992 |
| 364 | Ga0466706_029356 | 3300042599 | Bacteria | 3415 |
| 365 | Ga0466706_169251 | 3300042599 | Bacteria | 2322 |
| 366 | Ga0466713_013904 | 3300042602 | Bacteria | 4633 |
| 367 | Ga0466713_018853 | 3300042602 | Bacteria | 13634 |
| 368 | Ga0466713_030797 | 3300042602 | Bacteria | 38314 |
| 369 | Ga0466713_112803 | 3300042602 | Bacteria | 145809 |
| 370 | Ga0466717_208932 | 3300042604 | Bacteria | 13947 |
| 371 | Ga0466716_014479 | 3300042605 | Bacteria | 30537 |
| 372 | Ga0466719_525017 | 3300042606 | Bacteria | 1300 |
| 373 | Ga0160453_100158 | 3300012814 | Bacteria | 68251 |
| 374 | Ga0466690_032772 | 3300042590 | Bacteria | 29534 |
| 375 | Ga0466690_175771 | 3300042590 | Bacteria | 56622 |
| 376 | Ga0466690_261027 | 3300042590 | Bacteria | 17850 |
| 377 | Ga0466693_004110 | 3300042592 | Bacteria | 2918 |
| 378 | Ga0466691_039529 | 3300042593 | Bacteria | 29822 |
| 379 | Ga0466694_155058 | 3300042594 | Bacteria | 1967 |
| 380 | Ga0466699_127334 | 3300042597 | Bacteria | 4464 |
| 381 | 2227497987 | 2225789004 | Bacteria | 3875 |
| 382 | IMNBL1DRAFT_c0034636 | 3300000062 | Bacteria | 1794 |
| 383 | JGI24702J35022_10000840 | 3300002462 | Bacteria | 18966 |
| 384 | JGI24702J35022_10022980 | 3300002462 | Bacteria | 3372 |
| 385 | JGI24702J35022_10656254 | 3300002462 | Bacteria | 651 |
| 386 | Ga0068305_10000087 | 3300005083 | Bacteria | 586632 |
| 387 | Ga0466731_407601 | 3300042622 | Bacteria | 3862 |
| 388 | Ga0466734_058922 | 3300042623 | Bacteria | 1355 |
| 389 | Ga0466735_176465 | 3300042624 | Bacteria | 8295 |
| 390 | Ga0466735_211425 | 3300042624 | Bacteria | 2579 |
| 391 | Ga0466703_020705 | 3300042636 | Bacteria | 5568 |
| 392 | Ga0466703_180446 | 3300042636 | Bacteria | 15145 |
| 393 | Ga0466704_055849 | 3300042643 | Bacteria | 53217 |
| 394 | Ga0466704_477103 | 3300042643 | Bacteria | 9640 |
| 395 | Ga0466708_340350 | 3300042652 | Bacteria | 78722 |
| 396 | Ga0466727_050462 | 3300042655 | Bacteria | 20965 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00347 | Ribosomal_L6 | Ribosomal protein L6 | 110 | 187 | 0.98 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.