Protein Family IF06357
Metagenome
Isolate
225
Members
64
Samples
216
Scaffolds
140.75
Avg Length
Representative Sequence
- ID
- 3300042605|Ga0466716_185020|Ga0466716_185020_719_1240
- Length
- 173 aa
- Sequence
- LTIYFYEDIIKDNIYNNNVKTLFCKNLNGENLKMMKNPQETIGNLIEKQGVSFISSIDEDGFPNTKAMLPPVKREGIKTFYWHTNAPSMRIKQYRNNQKACIYFYDKRFFRGVMLKGKMEVLDDKKIKKEIWKDDFSMYYKDGVDGGDFIIIKFTAERGRYYSNFSSEDFKIE
Sample Types
Isolate
4.0%
Metagenome
96.0%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
55.6%
Kalotermitidae
17.5%
Unclassified
17.5%
Rhinotermitidae
3.2%
Termopsidae
3.2%
Hodotermitidae
1.6%
Passalidae
1.6%
Taxonomy
Archaea
4
Bacteria
187
Eukaryota
0
Viruses
0
Unclassified
34
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 2 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 3 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 4 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 5 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 6 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 7 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 8 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 9 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 10 | 3300002507 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 | Metagenome | Termitidae |
| 11 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 12 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 13 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 14 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 15 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 16 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 17 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 18 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 19 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 20 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 21 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 22 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 23 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 24 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 25 | 2820053807 | Unclassified Proteobacteria Th196P3bin117 | Isolate | Unclassified |
| 26 | 2820741847 | Unclassified Bacteroidetes Th196P3bin71 | Isolate | Unclassified |
| 27 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 28 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 29 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 30 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 31 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 32 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 33 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 34 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 35 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 36 | 2820803007 | Unclassified Actinobacteria Th196P3bin61 | Isolate | Unclassified |
| 37 | 2781125693 | Treponema sp. Th196P3bin148 | Isolate | Unclassified |
| 38 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 39 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 40 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 41 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 42 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 43 | 2820789850 | Unclassified Bacteroidetes Cu122P3bin3 | Isolate | Unclassified |
| 44 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 45 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 46 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 47 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 48 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 49 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 50 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 51 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 52 | 2740892547 | Fibrobacteria bacterium GUT77 MC_77 | Isolate | Unclassified |
| 53 | 2820556368 | Unclassified Firmicutes Emb289P3bin92 | Isolate | Unclassified |
| 54 | 2820724199 | Unclassified Cloacimonetes Th196P3bin22 | Isolate | Unclassified |
| 55 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 56 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 57 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 58 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 59 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 60 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 61 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 62 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 63 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 64 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466697_245308 | 3300042611 | Bacteria | 2398 |
| 2 | Ga0466705_056006 | 3300042612 | Bacteria | 3004 |
| 3 | Ga0466733_039731 | 3300042659 | Bacteria | 6468 |
| 4 | Ga0466702_120275 | 3300042635 | Bacteria | 1804 |
| 5 | Ga0466704_145981 | 3300042643 | Bacteria | 6814 |
| 6 | Ga0466708_020764 | 3300042652 | Bacteria | 1049 |
| 7 | Ga0466690_068650 | 3300042590 | Bacteria | 1377 |
| 8 | Ga0466692_002215 | 3300042591 | Bacteria | 38338 |
| 9 | Ga0123356_12622391 | 3300010049 | Bacteria | 631 |
| 10 | Ga0123353_10086923 | 3300010167 | Bacteria | 5036 |
| 11 | Ga0123353_10634854 | 3300010167 | Bacteria | 1516 |
| 12 | Ga0123353_11001820 | 3300010167 | Bacteria | 1122 |
| 13 | Ga0123354_10235454 | 3300010882 | Bacteria | 1901 |
| 14 | Ga0466714_006528 | 3300042603 | Bacteria | 26213 |
| 15 | Ga0466720_040728 | 3300042607 | Bacteria | 9733 |
| 16 | Ga0466720_112474 | 3300042607 | Bacteria | 12124 |
| 17 | Ga0466720_167947 | 3300042607 | Bacteria | 9381 |
| 18 | JGI24698J34947_10099808 | 3300002449 | Unclassified | 1308 |
| 19 | JGI24698J34947_10155982 | 3300002449 | Unclassified | 941 |
| 20 | JGI24695J34938_10262978 | 3300002450 | Bacteria | 735 |
| 21 | JGI24702J35022_10000827 | 3300002462 | Bacteria | 19155 |
| 22 | Ga0068305_10089161 | 3300005083 | Bacteria | 571 |
| 23 | Ga0466712_079936 | 3300042614 | Bacteria | 1193 |
| 24 | Ga0466715_116186 | 3300042616 | Bacteria | 1743 |
| 25 | Ga0466732_036299 | 3300042656 | Bacteria | 3232 |
| 26 | Ga0466704_133609 | 3300042643 | Bacteria | 4051 |
| 27 | Ga0466704_396616 | 3300042643 | Bacteria | 13019 |
| 28 | Ga0466708_227622 | 3300042652 | Unclassified | 1052 |
| 29 | Ga0466725_160737 | 3300042654 | Bacteria | 2106 |
| 30 | Ga0466725_317217 | 3300042654 | Bacteria | 1665 |
| 31 | Ga0466691_029721 | 3300042593 | Bacteria | 2788 |
| 32 | Ga0466694_050341 | 3300042594 | Bacteria | 20298 |
| 33 | Ga0466694_098818 | 3300042594 | Bacteria | 1359 |
| 34 | Ga0123357_10061468 | 3300009784 | Bacteria | 5034 |
| 35 | Ga0123355_11105086 | 3300009826 | Bacteria | 824 |
| 36 | Ga0123356_10153960 | 3300010049 | Bacteria | 2287 |
| 37 | Ga0123356_10229396 | 3300010049 | Bacteria | 1920 |
| 38 | Ga0123356_11088968 | 3300010049 | Bacteria | 967 |
| 39 | Ga0123354_10080546 | 3300010882 | Archaea | 4609 |
| 40 | Ga0123354_10233310 | 3300010882 | Unclassified | 1916 |
| 41 | Ga0466706_105100 | 3300042599 | Bacteria | 1441 |
| 42 | Ga0466713_111708 | 3300042602 | Bacteria | 2021 |
| 43 | Ga0466719_554193 | 3300042606 | Bacteria | 13976 |
| 44 | Ga0466698_144544 | 3300042610 | Bacteria | 2373 |
| 45 | AustNasuHG_c1068762 | 3300000089 | Bacteria | 647 |
| 46 | JGI24702J35022_10019224 | 3300002462 | Bacteria | 3717 |
| 47 | JGI24696J40584_12795033 | 3300002834 | Bacteria | 859 |
| 48 | JGI24696J40584_12955967 | 3300002834 | Bacteria | 2978 |
| 49 | Ga0072940_1016680 | 3300005200 | Bacteria | 1881 |
| 50 | Ga0466718_042101 | 3300042617 | Bacteria | 3210 |
| 51 | Ga0466733_083921 | 3300042659 | Bacteria | 2219 |
| 52 | Ga0466709_244666 | 3300042648 | Bacteria | 3963 |
| 53 | Ga0466708_004509 | 3300042652 | Bacteria | 29616 |
| 54 | Ga0466708_087690 | 3300042652 | Bacteria | 22180 |
| 55 | Ga0466708_122925 | 3300042652 | Bacteria | 2013 |
| 56 | Ga0466694_374747 | 3300042594 | Bacteria | 1080 |
| 57 | Ga0123356_10009257 | 3300010049 | Bacteria | 9731 |
| 58 | Ga0123356_10106601 | 3300010049 | Bacteria | 2698 |
| 59 | Ga0123356_10424712 | 3300010049 | Bacteria | 1472 |
| 60 | Ga0123356_11631857 | 3300010049 | Bacteria | 799 |
| 61 | Ga0123353_11115031 | 3300010167 | Bacteria | 1046 |
| 62 | Ga0123353_11362502 | 3300010167 | Bacteria | 915 |
| 63 | Ga0123354_10400459 | 3300010882 | Bacteria | 1163 |
| 64 | Ga0123354_10418984 | 3300010882 | Bacteria | 1115 |
| 65 | Ga0123354_10933880 | 3300010882 | Bacteria | 565 |
| 66 | Ga0466701_091389 | 3300042598 | Bacteria | 105479 |
| 67 | Ga0466706_009277 | 3300042599 | Bacteria | 9710 |
| 68 | Ga0466706_147990 | 3300042599 | Bacteria | 1328 |
| 69 | Ga0466707_296444 | 3300042601 | Bacteria | 4662 |
| 70 | Ga0466716_003934 | 3300042605 | Bacteria | 1264 |
| 71 | Ga0466719_143019 | 3300042606 | Bacteria | 1469 |
| 72 | Ga0466720_184217 | 3300042607 | Bacteria | 2256 |
| 73 | AustNasuHG_c1010394 | 3300000089 | Bacteria | 3244 |
| 74 | JGI24698J34947_10015283 | 3300002449 | Unclassified | 4180 |
| 75 | JGI24698J34947_10039541 | 3300002449 | Bacteria | 2441 |
| 76 | JGI24702J35022_10054085 | 3300002462 | Unclassified | 2141 |
| 77 | JGI24702J35022_10148796 | 3300002462 | Bacteria | 1312 |
| 78 | JGI24705J35276_12146001 | 3300002504 | Unclassified | 1161 |
| 79 | Ga0466710_280538 | 3300042613 | Bacteria | 2090 |
| 80 | Ga0466712_025762 | 3300042614 | Bacteria | 1053 |
| 81 | Ga0466712_230131 | 3300042614 | Bacteria | 1388 |
| 82 | Ga0466723_354478 | 3300042618 | Bacteria | 1102 |
| 83 | Ga0466729_122520 | 3300042621 | Bacteria | 2712 |
| 84 | Ga0466697_200697 | 3300042611 | Bacteria | 1818 |
| 85 | Ga0466697_201424 | 3300042611 | Bacteria | 1047 |
| 86 | Ga0466697_234548 | 3300042611 | Bacteria | 1683 |
| 87 | Ga0466732_260855 | 3300042656 | Unclassified | 1616 |
| 88 | Ga0466732_342128 | 3300042656 | Bacteria | 1881 |
| 89 | Ga0466731_398686 | 3300042622 | Bacteria | 3182 |
| 90 | Ga0466656_238739 | 3300042550 | Unclassified | 1833 |
| 91 | Ga0466690_212658 | 3300042590 | Bacteria | 1053 |
| 92 | Ga0466691_064450 | 3300042593 | Bacteria | 2967 |
| 93 | Ga0123357_10423594 | 3300009784 | Bacteria | 1185 |
| 94 | Ga0123355_11877923 | 3300009826 | Bacteria | 561 |
| 95 | Ga0123356_10780700 | 3300010049 | Bacteria | 1126 |
| 96 | Ga0123356_11143866 | 3300010049 | Bacteria | 946 |
| 97 | Ga0123356_11367471 | 3300010049 | Bacteria | 869 |
| 98 | Ga0123356_12479061 | 3300010049 | Bacteria | 649 |
| 99 | Ga0123353_10301854 | 3300010167 | Bacteria | 2443 |
| 100 | Ga0123353_12022378 | 3300010167 | Bacteria | 705 |
| 101 | Ga0123353_12717254 | 3300010167 | Bacteria | 582 |
| 102 | Ga0466706_081780 | 3300042599 | Unclassified | 13837 |
| 103 | Ga0466707_109820 | 3300042601 | Bacteria | 1093 |
| 104 | Ga0466716_185020 | 3300042605 | Bacteria | 75411 |
| 105 | Ga0466719_216283 | 3300042606 | Unclassified | 2121 |
| 106 | Ga0466721_085709 | 3300042608 | Bacteria | 1608 |
| 107 | JGI24702J35022_10096943 | 3300002462 | Bacteria | 1610 |
| 108 | JGI24702J35022_10255152 | 3300002462 | Bacteria | 1021 |
| 109 | JGI24702J35022_10488078 | 3300002462 | Bacteria | 754 |
| 110 | Ga0072940_1211687 | 3300005200 | Bacteria | 1196 |
| 111 | Ga0466705_400165 | 3300042612 | Bacteria | 1558 |
| 112 | Ga0466710_079503 | 3300042613 | Bacteria | 2133 |
| 113 | Ga0466726_029240 | 3300042619 | Bacteria | 4083 |
| 114 | Ga0264413_100533 | 3300024493 | Unclassified | 1015 |
| 115 | Ga0123356_10040246 | 3300010049 | Bacteria | 4355 |
| 116 | Ga0123356_11355138 | 3300010049 | Bacteria | 873 |
| 117 | Ga0123353_10103608 | 3300010167 | Bacteria | 4586 |
| 118 | Ga0123353_10254575 | 3300010167 | Archaea | 2716 |
| 119 | Ga0123353_11354267 | 3300010167 | Bacteria | 919 |
| 120 | Ga0123353_11913573 | 3300010167 | Bacteria | 731 |
| 121 | Ga0466701_099189 | 3300042598 | Bacteria | 12177 |
| 122 | Ga0466706_072658 | 3300042599 | Bacteria | 1859 |
| 123 | Ga0466706_211082 | 3300042599 | Unclassified | 1114 |
| 124 | Ga0466706_265202 | 3300042599 | Unclassified | 1297 |
| 125 | Ga0466714_092220 | 3300042603 | Bacteria | 69067 |
| 126 | Ga0466719_121318 | 3300042606 | Bacteria | 11457 |
| 127 | Ga0466720_022026 | 3300042607 | Unclassified | 2126 |
| 128 | Ga0466720_213159 | 3300042607 | Bacteria | 13116 |
| 129 | Ga0466698_135560 | 3300042610 | Bacteria | 1165 |
| 130 | Ga0466698_136947 | 3300042610 | Bacteria | 1244 |
| 131 | Ga0466698_469656 | 3300042610 | Bacteria | 1213 |
| 132 | IMNBL1DRAFT_c0026030 | 3300000062 | Bacteria | 2231 |
| 133 | AustNasuHG_c1060134 | 3300000089 | Unclassified | 741 |
| 134 | JGI24698J34947_10037327 | 3300002449 | Unclassified | 2525 |
| 135 | JGI24698J34947_10115987 | 3300002449 | Bacteria | 1172 |
| 136 | JGI24705J35276_11966226 | 3300002504 | Bacteria | 810 |
| 137 | JGI24696J40584_12958613 | 3300002834 | Bacteria | 4263 |
| 138 | Ga0466712_095485 | 3300042614 | Unclassified | 6821 |
| 139 | Ga0466729_097032 | 3300042621 | Unclassified | 1045 |
| 140 | Ga0466697_093819 | 3300042611 | Unclassified | 1017 |
| 141 | Ga0466733_058898 | 3300042659 | Bacteria | 2336 |
| 142 | Ga0466733_134873 | 3300042659 | Bacteria | 3230 |
| 143 | Ga0466734_011736 | 3300042623 | Bacteria | 6472 |
| 144 | Ga0466703_246477 | 3300042636 | Bacteria | 2257 |
| 145 | Ga0466704_071829 | 3300042643 | Bacteria | 6753 |
| 146 | Ga0466704_464817 | 3300042643 | Unclassified | 7598 |
| 147 | Ga0466709_119105 | 3300042648 | Bacteria | 26175 |
| 148 | Ga0466656_147464 | 3300042550 | Bacteria | 3623 |
| 149 | Ga0123355_10313887 | 3300009826 | Unclassified | 2121 |
| 150 | Ga0123356_10084932 | 3300010049 | Unclassified | 3001 |
| 151 | Ga0123356_11098800 | 3300010049 | Bacteria | 963 |
| 152 | Ga0123353_10958111 | 3300010167 | Bacteria | 1156 |
| 153 | Ga0466706_067779 | 3300042599 | Bacteria | 10546 |
| 154 | Ga0466706_185997 | 3300042599 | Unclassified | 2011 |
| 155 | Ga0466706_189146 | 3300042599 | Unclassified | 1016 |
| 156 | IMNBL1DRAFT_c0028473 | 3300000062 | Unclassified | 2083 |
| 157 | JGI24698J34947_10147884 | 3300002449 | Bacteria | 980 |
| 158 | JGI24702J35022_10050746 | 3300002462 | Bacteria | 2210 |
| 159 | JGI24702J35022_10790643 | 3300002462 | Bacteria | 591 |
| 160 | Ga0466710_156581 | 3300042613 | Bacteria | 1166 |
| 161 | Ga0466715_209162 | 3300042616 | Bacteria | 5951 |
| 162 | Ga0466718_141029 | 3300042617 | Bacteria | 1023 |
| 163 | Ga0466729_058225 | 3300042621 | Bacteria | 2170 |
| 164 | Ga0466735_049598 | 3300042624 | Bacteria | 1798 |
| 165 | Ga0466724_15143 | 3300042649 | Bacteria | 1149 |
| 166 | Ga0466692_135902 | 3300042591 | Bacteria | 2250 |
| 167 | Ga0466692_201269 | 3300042591 | Bacteria | 7502 |
| 168 | Ga0466693_417767 | 3300042592 | Bacteria | 1320 |
| 169 | Ga0466694_051046 | 3300042594 | Bacteria | 57740 |
| 170 | Ga0466699_191969 | 3300042597 | Bacteria | 1377 |
| 171 | Ga0123357_10361311 | 3300009784 | Bacteria | 1375 |
| 172 | Ga0123355_10504768 | 3300009826 | Bacteria | 1489 |
| 173 | Ga0123356_10449147 | 3300010049 | Unclassified | 1437 |
| 174 | Ga0123356_11414481 | 3300010049 | Bacteria | 856 |
| 175 | Ga0123356_11958809 | 3300010049 | Bacteria | 730 |
| 176 | Ga0123353_10123723 | 3300010167 | Bacteria | 4157 |
| 177 | Ga0123353_10703137 | 3300010167 | Bacteria | 1418 |
| 178 | Ga0123353_11199224 | 3300010167 | Unclassified | 996 |
| 179 | Ga0466700_225153 | 3300042600 | Bacteria | 1616 |
| 180 | Ga0466720_043347 | 3300042607 | Unclassified | 9854 |
| 181 | Ga0466720_181196 | 3300042607 | Unclassified | 3992 |
| 182 | JGI24698J34947_10162156 | 3300002449 | Bacteria | 914 |
| 183 | JGI24702J35022_10046960 | 3300002462 | Bacteria | 2298 |
| 184 | JGI24702J35022_10049686 | 3300002462 | Bacteria | 2234 |
| 185 | JGI24702J35022_10185873 | 3300002462 | Bacteria | 1183 |
| 186 | JGI24702J35022_10485353 | 3300002462 | Bacteria | 756 |
| 187 | JGI24696J40584_12932626 | 3300002834 | Bacteria | 1505 |
| 188 | Ga0466712_041476 | 3300042614 | Bacteria | 1080 |
| 189 | Ga0466718_156491 | 3300042617 | Bacteria | 1216 |
| 190 | Ga0466704_156663 | 3300042643 | Bacteria | 2211 |
| 191 | Ga0466704_469949 | 3300042643 | Bacteria | 3610 |
| 192 | Ga0466725_222320 | 3300042654 | Bacteria | 1977 |
| 193 | Ga0466657_349324 | 3300042582 | Unclassified | 4912 |
| 194 | Ga0466690_317511 | 3300042590 | Bacteria | 1203 |
| 195 | Ga0466693_026982 | 3300042592 | Bacteria | 1192 |
| 196 | Ga0466693_083933 | 3300042592 | Bacteria | 2151 |
| 197 | Ga0466699_027928 | 3300042597 | Bacteria | 1424 |
| 198 | Ga0123356_10110078 | 3300010049 | Bacteria | 2659 |
| 199 | Ga0123356_10166703 | 3300010049 | Bacteria | 2208 |
| 200 | Ga0123356_11467168 | 3300010049 | Unclassified | 841 |
| 201 | Ga0123353_10069151 | 3300010167 | Bacteria | 5672 |
| 202 | Ga0123353_11024872 | 3300010167 | Archaea | 1106 |
| 203 | Ga0123353_12533460 | 3300010167 | Bacteria | 609 |
| 204 | Ga0466706_038738 | 3300042599 | Bacteria | 6136 |
| 205 | Ga0466706_141192 | 3300042599 | Archaea | 1996 |
| 206 | Ga0466700_340041 | 3300042600 | Bacteria | 4562 |
| 207 | Ga0466720_122599 | 3300042607 | Unclassified | 2079 |
| 208 | Ga0466698_149021 | 3300042610 | Bacteria | 1643 |
| 209 | Ga0466698_459858 | 3300042610 | Bacteria | 5588 |
| 210 | JGI24695J34938_10063378 | 3300002450 | Bacteria | 1567 |
| 211 | JGI24702J35022_10320433 | 3300002462 | Bacteria | 919 |
| 212 | JGI24697J35500_11164542 | 3300002507 | Unclassified | 1420 |
| 213 | JGI24696J40584_12956853 | 3300002834 | Bacteria | 3261 |
| 214 | Ga0072940_1073366 | 3300005200 | Bacteria | 1649 |
| 215 | Ga0466710_152866 | 3300042613 | Bacteria | 1155 |
| 216 | Ga0466718_028667 | 3300042617 | Bacteria | 2148 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.