Protein Family IF06334
Metagenome
Isolate
204
Members
68
Samples
192
Scaffolds
338.5
Avg Length
Representative Sequence
- ID
- 3300042605|Ga0466716_116636|Ga0466716_116636_1557_2570
- Length
- 337 aa
- Sequence
- MEETNKGEIVIYRREDRDIRVHVRLEDGSVWLTQAQLVELYRSSKASVSEHIRHIFDEGEIQEDSVVRKIRTTAADGKSYEVAHYNLDLIIALGYRIKSPVATQFRIWATGRLREYVVKGFTMDDERLKNVGGGDYWHELLNRIRDIRSSEKVLYRQVLDLYATSIDYDPQSTVSVEFFKVVQNKLHYAAHGHTAAEVIYERADSNQPFMGLTVFSGDHPTLRDVAVAKNYLTEEELKVLNNLVSGYFDFAEIQAMRHKPMYMEDYVRQLDNILSSTGESVLKNAGTVSHTQALEKAKAEYKKYQVKTLSAVEQHYLETVKDVQKKISGKSRKPHNS
Sample Types
Isolate
5.9%
Metagenome
94.1%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
41.5%
Kalotermitidae
20.0%
Unclassified
18.5%
Rhinotermitidae
6.2%
Passalidae
4.6%
Termopsidae
4.6%
Blaberidae
1.5%
Blattidae
1.5%
Hodotermitidae
1.5%
Taxonomy
Archaea
4
Bacteria
191
Eukaryota
0
Viruses
0
Unclassified
9
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 2 | 2772190975 | Treponema sp. RmG30 | Isolate | Blaberidae |
| 3 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 4 | 2609459943 | Bacteroides reticulotermitis JCM 10512 | Isolate | Rhinotermitidae |
| 5 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 6 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 7 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 8 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 9 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 10 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 11 | 2820946191 | Unclassified Acidobacteria Nt197P3bin31 | Isolate | Unclassified |
| 12 | 2820220859 | Unclassified Firmicutes Th196P4bin59 | Isolate | Unclassified |
| 13 | 2820671341 | Unclassified Firmicutes Co191P3bin20 | Isolate | Unclassified |
| 14 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 15 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 16 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 17 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 18 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 19 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 20 | 2940209341 | Parabacteroides sp. PFB2-10 | Isolate | Blattidae |
| 21 | 2820634724 | Unclassified Firmicutes Emb289P1bin116 | Isolate | Unclassified |
| 22 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 23 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 24 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 25 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 26 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 27 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 28 | 2830041218 | Bacteroides reticulotermitis DSM 105720 | Isolate | Unclassified |
| 29 | 2225789003 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) | Metagenome | Passalidae |
| 30 | 2820558799 | Unclassified Firmicutes Emb289P3bin74 | Isolate | Unclassified |
| 31 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 32 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 33 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 34 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 35 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 36 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 37 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 38 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 39 | 2820719201 | Unclassified Fibrobacteres Lab288P3bin119 | Isolate | Unclassified |
| 40 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 41 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 42 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 43 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 44 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 45 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 46 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 47 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 48 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 49 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 50 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 51 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 52 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 53 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 54 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 55 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 56 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 57 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 58 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 59 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 60 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 61 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 62 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 63 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 64 | 2820831444 | Unclassified Actinobacteria Nc150P4bin21 | Isolate | Unclassified |
| 65 | 2820711732 | Unclassified Firmicutes Co191P1bin26 | Isolate | Unclassified |
| 66 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 67 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 68 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466732_400810 | 3300042656 | Bacteria | 1921 |
| 2 | Ga0466733_003120 | 3300042659 | Bacteria | 6103 |
| 3 | Ga0466733_216185 | 3300042659 | Bacteria | 59972 |
| 4 | Ga0466706_094104 | 3300042599 | Bacteria | 1357 |
| 5 | Ga0466706_120334 | 3300042599 | Bacteria | 4075 |
| 6 | Ga0466700_078006 | 3300042600 | Bacteria | 4511 |
| 7 | Ga0466714_108173 | 3300042603 | Bacteria | 16142 |
| 8 | Ga0466719_413922 | 3300042606 | Bacteria | 1609 |
| 9 | Ga0466720_128554 | 3300042607 | Bacteria | 11884 |
| 10 | Ga0466722_231247 | 3300042609 | Bacteria | 8490 |
| 11 | Ga0466731_292739 | 3300042622 | Bacteria | 1062 |
| 12 | Ga0466734_064463 | 3300042623 | Bacteria | 5042 |
| 13 | Ga0466734_075259 | 3300042623 | Bacteria | 2512 |
| 14 | Ga0466703_022920 | 3300042636 | Archaea | 57762 |
| 15 | Ga0466703_262792 | 3300042636 | Bacteria | 5331 |
| 16 | Ga0466704_172456 | 3300042643 | Bacteria | 26101 |
| 17 | Ga0466704_326053 | 3300042643 | Unclassified | 5214 |
| 18 | Ga0466704_332711 | 3300042643 | Bacteria | 13363 |
| 19 | Ga0466709_397404 | 3300042648 | Bacteria | 20612 |
| 20 | Ga0265387_1008449 | 3300024582 | Bacteria | 1384 |
| 21 | Ga0466694_404950 | 3300042594 | Bacteria | 2089 |
| 22 | Ga0466696_439534 | 3300042596 | Bacteria | 1524 |
| 23 | Ga0466705_442410 | 3300042612 | Bacteria | 5998 |
| 24 | Ga0466726_142262 | 3300042619 | Bacteria | 5936 |
| 25 | Ga0466728_131145 | 3300042620 | Bacteria | 2077 |
| 26 | IMNBL1DRAFT_c0003365 | 3300000062 | Bacteria | 10372 |
| 27 | AustNasuHG_c1030359 | 3300000089 | Bacteria | 1557 |
| 28 | JGI24702J35022_10006245 | 3300002462 | Bacteria | 6899 |
| 29 | Ga0072941_1032976 | 3300005201 | Bacteria | 15872 |
| 30 | Ga0466705_004115 | 3300042612 | Bacteria | 7494 |
| 31 | Ga0466733_033499 | 3300042659 | Bacteria | 15025 |
| 32 | Ga0466707_014408 | 3300042601 | Bacteria | 7037 |
| 33 | Ga0466707_098843 | 3300042601 | Bacteria | 5482 |
| 34 | Ga0466707_132813 | 3300042601 | Bacteria | 12489 |
| 35 | Ga0466707_240968 | 3300042601 | Bacteria | 8586 |
| 36 | Ga0466707_286354 | 3300042601 | Bacteria | 2958 |
| 37 | Ga0466713_042887 | 3300042602 | Bacteria | 1980 |
| 38 | Ga0466734_144012 | 3300042623 | Bacteria | 1414 |
| 39 | Ga0466725_271824 | 3300042654 | Bacteria | 38072 |
| 40 | Ga0466727_319211 | 3300042655 | Bacteria | 5852 |
| 41 | Ga0264413_110011 | 3300024493 | Bacteria | 12497 |
| 42 | Ga0264413_131955 | 3300024493 | Bacteria | 11415 |
| 43 | Ga0466694_280350 | 3300042594 | Bacteria | 1160 |
| 44 | Ga0123353_10000745 | 3300010167 | Bacteria | 39492 |
| 45 | Ga0466711_025303 | 3300042615 | Bacteria | 1988 |
| 46 | Ga0466715_196734 | 3300042616 | Bacteria | 9515 |
| 47 | Ga0466718_030387 | 3300042617 | Bacteria | 8556 |
| 48 | Ga0466726_014805 | 3300042619 | Bacteria | 2605 |
| 49 | Ga0466726_204859 | 3300042619 | Bacteria | 1104 |
| 50 | Ga0466728_095606 | 3300042620 | Bacteria | 1710 |
| 51 | IMNBL1DRAFT_c0020470 | 3300000062 | Bacteria | 2679 |
| 52 | AustNasuHG_c1008762 | 3300000089 | Bacteria | 3578 |
| 53 | AustNasuHG_c1029799 | 3300000089 | Bacteria | 1588 |
| 54 | JGI24698J34947_10000167 | 3300002449 | Bacteria | 25410 |
| 55 | JGI24698J34947_10013574 | 3300002449 | Bacteria | 4445 |
| 56 | JGI24695J34938_10000824 | 3300002450 | Bacteria | 28821 |
| 57 | Ga0466733_095137 | 3300042659 | Bacteria | 1634 |
| 58 | Ga0466733_115480 | 3300042659 | Bacteria | 1507 |
| 59 | Ga0466706_179014 | 3300042599 | Bacteria | 61419 |
| 60 | Ga0466707_119591 | 3300042601 | Bacteria | 1879 |
| 61 | Ga0466707_309971 | 3300042601 | Bacteria | 2445 |
| 62 | Ga0466713_123884 | 3300042602 | Bacteria | 1898 |
| 63 | Ga0466731_128444 | 3300042622 | Bacteria | 4462 |
| 64 | Ga0466731_272421 | 3300042622 | Bacteria | 1449 |
| 65 | Ga0466703_197231 | 3300042636 | Bacteria | 13264 |
| 66 | Ga0466703_203043 | 3300042636 | Bacteria | 6127 |
| 67 | Ga0466704_148028 | 3300042643 | Unclassified | 11572 |
| 68 | Ga0466725_380346 | 3300042654 | Bacteria | 2974 |
| 69 | Ga0466727_173493 | 3300042655 | Bacteria | 18839 |
| 70 | Ga0466690_041758 | 3300042590 | Bacteria | 2121 |
| 71 | Ga0466696_113521 | 3300042596 | Bacteria | 41827 |
| 72 | Ga0123356_10436761 | 3300010049 | Bacteria | 1454 |
| 73 | Ga0123353_10003004 | 3300010167 | Bacteria | 21125 |
| 74 | Ga0123353_10291110 | 3300010167 | Bacteria | 2500 |
| 75 | Ga0123353_10775388 | 3300010167 | Bacteria | 1329 |
| 76 | Ga0466705_437875 | 3300042612 | Bacteria | 1486 |
| 77 | Ga0466711_025258 | 3300042615 | Bacteria | 45468 |
| 78 | Ga0466711_067304 | 3300042615 | Bacteria | 1250 |
| 79 | Ga0466711_069341 | 3300042615 | Bacteria | 69315 |
| 80 | Ga0466711_122715 | 3300042615 | Bacteria | 7108 |
| 81 | Ga0466711_266206 | 3300042615 | Bacteria | 3860 |
| 82 | Ga0466726_084081 | 3300042619 | Bacteria | 6458 |
| 83 | Ga0466726_089937 | 3300042619 | Bacteria | 1262 |
| 84 | Ga0466728_065585 | 3300042620 | Bacteria | 1096 |
| 85 | Ga0466729_047133 | 3300042621 | Bacteria | 9467 |
| 86 | 2227501582 | 2225789004 | Bacteria | 3788 |
| 87 | IMNBL1DRAFT_c0000045 | 3300000062 | Bacteria | 114518 |
| 88 | IMNBL1DRAFT_c0000444 | 3300000062 | Bacteria | 34756 |
| 89 | JGI24702J35022_10004305 | 3300002462 | Bacteria | 8488 |
| 90 | Ga0466705_015956 | 3300042612 | Bacteria | 2047 |
| 91 | Ga0466705_175300 | 3300042612 | Bacteria | 5208 |
| 92 | Ga0466705_229829 | 3300042612 | Bacteria | 1353 |
| 93 | Ga0466714_045578 | 3300042603 | Bacteria | 5785 |
| 94 | Ga0466714_129021 | 3300042603 | Bacteria | 2364 |
| 95 | Ga0466716_079514 | 3300042605 | Unclassified | 17801 |
| 96 | Ga0466719_305821 | 3300042606 | Bacteria | 1314 |
| 97 | Ga0466729_286783 | 3300042621 | Bacteria | 1884 |
| 98 | Ga0466734_038848 | 3300042623 | Archaea | 16796 |
| 99 | Ga0466702_014325 | 3300042635 | Bacteria | 1577 |
| 100 | Ga0466704_048167 | 3300042643 | Bacteria | 9597 |
| 101 | Ga0466704_261846 | 3300042643 | Bacteria | 6377 |
| 102 | Ga0264413_115724 | 3300024493 | Bacteria | 1214 |
| 103 | Ga0466696_204011 | 3300042596 | Bacteria | 5094 |
| 104 | Ga0123356_10371568 | 3300010049 | Bacteria | 1560 |
| 105 | Ga0123356_10422109 | 3300010049 | Bacteria | 1476 |
| 106 | Ga0466712_116232 | 3300042614 | Bacteria | 1111 |
| 107 | Ga0466711_280564 | 3300042615 | Bacteria | 8476 |
| 108 | Ga0466729_081091 | 3300042621 | Bacteria | 5534 |
| 109 | Ga0466729_166378 | 3300042621 | Bacteria | 1264 |
| 110 | IMNBL1DRAFT_c0038036 | 3300000062 | Bacteria | 1660 |
| 111 | Ga0068305_10379687 | 3300005083 | Bacteria | 1232 |
| 112 | Ga0466705_129799 | 3300042612 | Bacteria | 3582 |
| 113 | Ga0466733_188132 | 3300042659 | Bacteria | 1898 |
| 114 | Ga0466706_166865 | 3300042599 | Unclassified | 14407 |
| 115 | Ga0466706_255820 | 3300042599 | Bacteria | 4931 |
| 116 | Ga0466707_109335 | 3300042601 | Bacteria | 18895 |
| 117 | Ga0466707_286606 | 3300042601 | Bacteria | 1219 |
| 118 | Ga0466717_231829 | 3300042604 | Bacteria | 1996 |
| 119 | Ga0466716_116636 | 3300042605 | Bacteria | 3741 |
| 120 | Ga0466716_358018 | 3300042605 | Bacteria | 2088 |
| 121 | Ga0466721_212023 | 3300042608 | Bacteria | 1189 |
| 122 | Ga0466727_104488 | 3300042655 | Archaea | 1435 |
| 123 | Ga0466727_191999 | 3300042655 | Bacteria | 1853 |
| 124 | Ga0466696_290099 | 3300042596 | Unclassified | 1272 |
| 125 | Ga0123357_10345239 | 3300009784 | Bacteria | 1433 |
| 126 | Ga0123354_10247535 | 3300010882 | Bacteria | 1815 |
| 127 | Ga0466711_515405 | 3300042615 | Bacteria | 2959 |
| 128 | Ga0466723_218913 | 3300042618 | Bacteria | 18660 |
| 129 | Ga0466729_128850 | 3300042621 | Bacteria | 1479 |
| 130 | 2226985944 | 2225789003 | Bacteria | 7911 |
| 131 | 2227323852 | 2225789004 | Bacteria | 1184 |
| 132 | Ga0466705_369452 | 3300042612 | Bacteria | 8238 |
| 133 | Ga0466732_399713 | 3300042656 | Bacteria | 3025 |
| 134 | Ga0466733_128787 | 3300042659 | Bacteria | 4610 |
| 135 | Ga0466733_181704 | 3300042659 | Bacteria | 1163 |
| 136 | Ga0466716_004650 | 3300042605 | Bacteria | 2520 |
| 137 | Ga0466720_070734 | 3300042607 | Bacteria | 10485 |
| 138 | Ga0466722_014050 | 3300042609 | Bacteria | 6034 |
| 139 | Ga0466697_034899 | 3300042611 | Bacteria | 2095 |
| 140 | Ga0466729_264517 | 3300042621 | Bacteria | 26130 |
| 141 | Ga0466735_100804 | 3300042624 | Bacteria | 4819 |
| 142 | Ga0466702_384345 | 3300042635 | Bacteria | 1988 |
| 143 | Ga0466703_015403 | 3300042636 | Bacteria | 15429 |
| 144 | Ga0466703_200318 | 3300042636 | Bacteria | 5141 |
| 145 | Ga0466704_163255 | 3300042643 | Bacteria | 5080 |
| 146 | Ga0466725_336562 | 3300042654 | Bacteria | 6345 |
| 147 | Ga0264413_101524 | 3300024493 | Unclassified | 12662 |
| 148 | Ga0264413_115790 | 3300024493 | Bacteria | 2127 |
| 149 | Ga0466657_328206 | 3300042582 | Bacteria | 12184 |
| 150 | Ga0466692_130373 | 3300042591 | Bacteria | 1957 |
| 151 | Ga0466691_065384 | 3300042593 | Bacteria | 40870 |
| 152 | Ga0123357_10043338 | 3300009784 | Bacteria | 6115 |
| 153 | Ga0123356_10045431 | 3300010049 | Bacteria | 4087 |
| 154 | Ga0123356_10559723 | 3300010049 | Bacteria | 1305 |
| 155 | Ga0466715_300742 | 3300042616 | Bacteria | 10321 |
| 156 | JGI24702J35022_10127270 | 3300002462 | Bacteria | 1411 |
| 157 | Ga0466705_287979 | 3300042612 | Bacteria | 17567 |
| 158 | Ga0466706_190569 | 3300042599 | Bacteria | 1301 |
| 159 | Ga0466707_147300 | 3300042601 | Bacteria | 3405 |
| 160 | Ga0466714_027516 | 3300042603 | Bacteria | 2096 |
| 161 | Ga0466714_059458 | 3300042603 | Bacteria | 5775 |
| 162 | Ga0466714_162413 | 3300042603 | Bacteria | 5353 |
| 163 | Ga0466716_372188 | 3300042605 | Unclassified | 1876 |
| 164 | Ga0466703_254670 | 3300042636 | Bacteria | 13738 |
| 165 | Ga0466704_253283 | 3300042643 | Bacteria | 11508 |
| 166 | Ga0466657_044925 | 3300042582 | Bacteria | 2940 |
| 167 | Ga0466690_167381 | 3300042590 | Bacteria | 10542 |
| 168 | Ga0466705_525711 | 3300042612 | Bacteria | 1722 |
| 169 | Ga0072940_1323923 | 3300005200 | Bacteria | 1461 |
| 170 | Ga0072941_1001755 | 3300005201 | Bacteria | 19983 |
| 171 | Ga0466706_130015 | 3300042599 | Bacteria | 11324 |
| 172 | Ga0466707_122047 | 3300042601 | Archaea | 3164 |
| 173 | Ga0466707_387519 | 3300042601 | Bacteria | 1849 |
| 174 | Ga0466719_389448 | 3300042606 | Bacteria | 2574 |
| 175 | Ga0466731_341774 | 3300042622 | Bacteria | 1339 |
| 176 | Ga0466735_210296 | 3300042624 | Bacteria | 2332 |
| 177 | Ga0466702_348767 | 3300042635 | Bacteria | 2720 |
| 178 | Ga0466704_035124 | 3300042643 | Bacteria | 2674 |
| 179 | Ga0466690_207409 | 3300042590 | Bacteria | 33870 |
| 180 | Ga0466699_025233 | 3300042597 | Bacteria | 3368 |
| 181 | Ga0123355_10011608 | 3300009826 | Bacteria | 13590 |
| 182 | Ga0123355_10032260 | 3300009826 | Bacteria | 8501 |
| 183 | Ga0466715_623388 | 3300042616 | Bacteria | 9065 |
| 184 | Ga0466718_029210 | 3300042617 | Bacteria | 1443 |
| 185 | Ga0466729_095556 | 3300042621 | Bacteria | 4687 |
| 186 | Ga0466729_170379 | 3300042621 | Bacteria | 23377 |
| 187 | 2227354962 | 2225789004 | Bacteria | 1135 |
| 188 | IMNBL1DRAFT_c0027760 | 3300000062 | Unclassified | 2122 |
| 189 | JGI24698J34947_10040286 | 3300002449 | Unclassified | 2413 |
| 190 | JGI24695J34938_10045985 | 3300002450 | Bacteria | 1933 |
| 191 | JGI24702J35022_10060475 | 3300002462 | Bacteria | 2025 |
| 192 | Ga0072941_1039411 | 3300005201 | Bacteria | 9118 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF13310 | Virulence_RhuM | Virulence protein RhuM family | 65 | 308 | 0.99 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.