Protein Family IF06311
Metagenome
Metatranscriptome
Isolate
157
Members
54
Samples
156
Scaffolds
427.82
Avg Length
Representative Sequence
- ID
- 3300042605|Ga0466716_049669|Ga0466716_049669_58_1497
- Length
- 479 aa
- Sequence
- VKGGAEKKTGRKSDAFIVAKKLLKESGAKEGGLLLFNEKIIDLNMGFKMIEEYIRYIKSFSEQNPNVRIQNLSSKVNKQALADLHQKMDARKAAGIDYVTKGEYSSNLEANLERLEMRLKLDRYAPKPSKRVHIPKAGGKLRPLGISCYEDKLVEANVAELLAAVYEPKFMNSSYGFRPERDCHQAISELRRQIIAEKTNFVVEADIKSFFDTMDHEWMMKFLEHDIADRKFLRLIGKFLKAGVMENGKFEERKEGTPQGSGISPVLANIYLHYVLDLWFEKAVKKECRGYAGIVRYADDFVCVFQYKSDAEKFMKELMERLKKFNLEAAPEKTKLIEFGKFAGQNRAARKEGKPETFNFLGFTLYCSKSVGGKFIVKLKTDRTRVAKKLKLLKEWLRKNRTMRTDELVEKLNKSLIGYYNYYYVSTNTKTVWTFVDKVGGLVFKWLNRRSQRKSYAWDEFKQSWVWLHLAKPRSPKPI
Sample Types
Isolate
0.6%
Metagenome
96.8%
MAG
0.0%
Metatranscriptome
2.5%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
59.6%
Kalotermitidae
21.2%
Unclassified
7.7%
Termopsidae
3.8%
Rhinotermitidae
3.8%
Passalidae
3.8%
Taxonomy
Archaea
1
Bacteria
143
Eukaryota
0
Viruses
0
Unclassified
13
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 2 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 3 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 4 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 5 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 6 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 7 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 8 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 9 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 10 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 11 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 12 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 13 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 14 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 15 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 16 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 17 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 18 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 19 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 20 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 21 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 22 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 23 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 24 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 25 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 26 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 27 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 28 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 29 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 30 | 3300022232 | Termite gut microbial communities from Cavitermes sp. nest - French Guiana - 28-9 mRNA | Metatranscriptome | Termitidae |
| 31 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 32 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 33 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 34 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 35 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 36 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 37 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 38 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 39 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 40 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 41 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 42 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 43 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 44 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 45 | 3300021190 | Termite gut microbial communities from nest - French Guiana - 1_3 mRNA 1_3 mRNA SA | Metatranscriptome | Termitidae |
| 46 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 47 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 48 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 49 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 50 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 51 | 2820223845 | Unclassified Firmicutes Th196P4bin57 | Isolate | Unclassified |
| 52 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 53 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 54 | 3300022815 | Termite gut microbial communities from Microcerotermes sp. nest - French Guiana - 27-16 mRNA | Metatranscriptome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | JGI24695J34938_10043812 | 3300002450 | Unclassified | 1994 |
| 2 | Ga0466693_262982 | 3300042592 | Bacteria | 2227 |
| 3 | Ga0123355_10253905 | 3300009826 | Bacteria | 2470 |
| 4 | Ga0123355_10329869 | 3300009826 | Bacteria | 2046 |
| 5 | Ga0123356_10122906 | 3300010049 | Bacteria | 2529 |
| 6 | Ga0123353_10218900 | 3300010167 | Bacteria | 2980 |
| 7 | Ga0123353_10432958 | 3300010167 | Bacteria | 1944 |
| 8 | Ga0123353_10475210 | 3300010167 | Bacteria | 1831 |
| 9 | Ga0466701_042074 | 3300042598 | Bacteria | 1782 |
| 10 | Ga0466719_153173 | 3300042606 | Bacteria | 2945 |
| 11 | Ga0466719_502883 | 3300042606 | Bacteria | 2107 |
| 12 | Ga0466697_158796 | 3300042611 | Bacteria | 2264 |
| 13 | Ga0466705_163778 | 3300042612 | Bacteria | 1962 |
| 14 | Ga0466725_105224 | 3300042654 | Bacteria | 2005 |
| 15 | Ga0466705_395162 | 3300042612 | Bacteria | 6055 |
| 16 | Ga0466710_319379 | 3300042613 | Bacteria | 3189 |
| 17 | Ga0466710_439388 | 3300042613 | Bacteria | 2014 |
| 18 | Ga0466712_046281 | 3300042614 | Bacteria | 1718 |
| 19 | Ga0466726_005480 | 3300042619 | Bacteria | 2767 |
| 20 | Ga0068305_10024903 | 3300005083 | Unclassified | 1964 |
| 21 | Ga0222431_1000295 | 3300021190 | Bacteria | 1961 |
| 22 | Ga0466656_321774 | 3300042550 | Bacteria | 1849 |
| 23 | Ga0466657_349902 | 3300042582 | Bacteria | 2249 |
| 24 | Ga0466692_101710 | 3300042591 | Bacteria | 2813 |
| 25 | Ga0466693_263333 | 3300042592 | Unclassified | 1566 |
| 26 | Ga0466694_086491 | 3300042594 | Bacteria | 2098 |
| 27 | Ga0123357_10225249 | 3300009784 | Bacteria | 2070 |
| 28 | Ga0123355_10280619 | 3300009826 | Bacteria | 2301 |
| 29 | Ga0123356_10070158 | 3300010049 | Bacteria | 3286 |
| 30 | Ga0123356_10186326 | 3300010049 | Bacteria | 2102 |
| 31 | Ga0123356_10215428 | 3300010049 | Bacteria | 1973 |
| 32 | Ga0123356_10227745 | 3300010049 | Bacteria | 1926 |
| 33 | Ga0123353_10271517 | 3300010167 | Bacteria | 2612 |
| 34 | Ga0123354_10244248 | 3300010882 | Bacteria | 1838 |
| 35 | Ga0466707_252800 | 3300042601 | Bacteria | 2428 |
| 36 | Ga0466713_117423 | 3300042602 | Bacteria | 2363 |
| 37 | Ga0466697_092052 | 3300042611 | Bacteria | 2687 |
| 38 | Ga0466725_132572 | 3300042654 | Bacteria | 1519 |
| 39 | Ga0466727_016613 | 3300042655 | Bacteria | 1420 |
| 40 | AustNasuHG_c1023278 | 3300000089 | Bacteria | 1979 |
| 41 | Ga0072941_1023110 | 3300005201 | Bacteria | 65992 |
| 42 | Ga0415639_083860 | 3300038395 | Unclassified | 1620 |
| 43 | Ga0415639_199937 | 3300038395 | Bacteria | 1408 |
| 44 | Ga0123356_10171314 | 3300010049 | Unclassified | 2182 |
| 45 | Ga0123356_10201018 | 3300010049 | Unclassified | 2032 |
| 46 | Ga0123356_10337286 | 3300010049 | Bacteria | 1626 |
| 47 | Ga0123353_10416649 | 3300010167 | Unclassified | 1992 |
| 48 | Ga0123354_10176083 | 3300010882 | Bacteria | 2465 |
| 49 | Ga0466717_128514 | 3300042604 | Bacteria | 2094 |
| 50 | Ga0466719_290769 | 3300042606 | Bacteria | 2167 |
| 51 | Ga0466729_286458 | 3300042621 | Bacteria | 2187 |
| 52 | Ga0466708_124976 | 3300042652 | Bacteria | 6788 |
| 53 | Ga0466725_043598 | 3300042654 | Bacteria | 2272 |
| 54 | Ga0466725_082128 | 3300042654 | Bacteria | 3451 |
| 55 | Ga0466705_481660 | 3300042612 | Bacteria | 1708 |
| 56 | Ga0466705_499938 | 3300042612 | Bacteria | 3628 |
| 57 | Ga0466715_160426 | 3300042616 | Bacteria | 3756 |
| 58 | Ga0466726_064029 | 3300042619 | Bacteria | 2608 |
| 59 | Ga0466726_257225 | 3300042619 | Bacteria | 2062 |
| 60 | 2227622690 | 2225789004 | Bacteria | 2178 |
| 61 | JGI24702J35022_10020568 | 3300002462 | Bacteria | 3582 |
| 62 | Ga0466690_136494 | 3300042590 | Bacteria | 2534 |
| 63 | Ga0466693_383690 | 3300042592 | Unclassified | 2370 |
| 64 | Ga0466721_228208 | 3300042608 | Bacteria | 1847 |
| 65 | Ga0466697_228472 | 3300042611 | Bacteria | 3568 |
| 66 | Ga0466705_043049 | 3300042612 | Bacteria | 3629 |
| 67 | Ga0466705_216979 | 3300042612 | Bacteria | 1928 |
| 68 | Ga0466704_057916 | 3300042643 | Bacteria | 5856 |
| 69 | Ga0466725_452334 | 3300042654 | Bacteria | 2101 |
| 70 | Ga0466711_094111 | 3300042615 | Bacteria | 3651 |
| 71 | Ga0466733_031130 | 3300042659 | Bacteria | 2503 |
| 72 | JGI24702J35022_10036851 | 3300002462 | Bacteria | 2613 |
| 73 | JGI24702J35022_10052201 | 3300002462 | Bacteria | 2179 |
| 74 | Ga0072941_1143039 | 3300005201 | Bacteria | 2188 |
| 75 | Ga0233288_1013353 | 3300022232 | Bacteria | 1919 |
| 76 | Ga0264413_146675 | 3300024493 | Bacteria | 1521 |
| 77 | Ga0415639_009597 | 3300038395 | Bacteria | 2012 |
| 78 | Ga0466656_045378 | 3300042550 | Bacteria | 2236 |
| 79 | Ga0466696_034525 | 3300042596 | Bacteria | 2704 |
| 80 | Ga0123357_10118697 | 3300009784 | Bacteria | 3341 |
| 81 | Ga0123357_10175487 | 3300009784 | Bacteria | 2521 |
| 82 | Ga0123355_10311584 | 3300009826 | Unclassified | 2132 |
| 83 | Ga0123356_10142090 | 3300010049 | Bacteria | 2369 |
| 84 | Ga0123356_10174836 | 3300010049 | Bacteria | 2162 |
| 85 | Ga0123353_10301081 | 3300010167 | Bacteria | 2448 |
| 86 | Ga0123353_10426832 | 3300010167 | Bacteria | 1962 |
| 87 | Ga0466719_363700 | 3300042606 | Bacteria | 20279 |
| 88 | Ga0466705_217718 | 3300042612 | Bacteria | 4116 |
| 89 | Ga0466705_328506 | 3300042612 | Bacteria | 1546 |
| 90 | Ga0466731_038324 | 3300042622 | Bacteria | 2058 |
| 91 | Ga0466703_368667 | 3300042636 | Bacteria | 2399 |
| 92 | Ga0466727_102173 | 3300042655 | Bacteria | 2202 |
| 93 | Ga0466726_157865 | 3300042619 | Bacteria | 1779 |
| 94 | Ga0466729_118540 | 3300042621 | Bacteria | 2681 |
| 95 | JGI24702J35022_10039106 | 3300002462 | Unclassified | 2531 |
| 96 | JGI24702J35022_10041064 | 3300002462 | Bacteria | 2466 |
| 97 | JGI24702J35022_10049415 | 3300002462 | Bacteria | 2240 |
| 98 | Ga0466657_038373 | 3300042582 | Bacteria | 2167 |
| 99 | Ga0466690_134625 | 3300042590 | Bacteria | 3177 |
| 100 | Ga0466693_050104 | 3300042592 | Unclassified | 2581 |
| 101 | Ga0123357_10131214 | 3300009784 | Archaea | 3118 |
| 102 | Ga0123356_10187126 | 3300010049 | Bacteria | 2098 |
| 103 | Ga0123353_10318169 | 3300010167 | Bacteria | 2363 |
| 104 | Ga0123353_10349579 | 3300010167 | Bacteria | 2228 |
| 105 | Ga0123353_10426439 | 3300010167 | Bacteria | 1963 |
| 106 | Ga0123353_10582859 | 3300010167 | Bacteria | 1604 |
| 107 | Ga0466719_558465 | 3300042606 | Bacteria | 2340 |
| 108 | Ga0466721_041560 | 3300042608 | Bacteria | 2855 |
| 109 | Ga0466697_176146 | 3300042611 | Unclassified | 1249 |
| 110 | Ga0466734_108691 | 3300042623 | Bacteria | 2287 |
| 111 | Ga0466703_370519 | 3300042636 | Bacteria | 1578 |
| 112 | Ga0466704_131410 | 3300042643 | Bacteria | 2069 |
| 113 | Ga0466704_412806 | 3300042643 | Bacteria | 40998 |
| 114 | Ga0466726_455201 | 3300042619 | Bacteria | 2132 |
| 115 | IMNBL1DRAFT_c0030017 | 3300000062 | Bacteria | 2000 |
| 116 | JGI24698J34947_10061371 | 3300002449 | Bacteria | 1851 |
| 117 | JGI24702J35022_10059799 | 3300002462 | Bacteria | 2036 |
| 118 | Ga0255786_1003222 | 3300022815 | Bacteria | 2088 |
| 119 | Ga0466656_012596 | 3300042550 | Bacteria | 2268 |
| 120 | Ga0123357_10163790 | 3300009784 | Bacteria | 2655 |
| 121 | Ga0123353_10017286 | 3300010167 | Bacteria | 10594 |
| 122 | Ga0123353_10139176 | 3300010167 | Bacteria | 3891 |
| 123 | Ga0123353_10226007 | 3300010167 | Bacteria | 2922 |
| 124 | Ga0466700_115699 | 3300042600 | Bacteria | 3653 |
| 125 | Ga0466717_233718 | 3300042604 | Bacteria | 1733 |
| 126 | Ga0466731_124081 | 3300042622 | Bacteria | 2794 |
| 127 | Ga0466703_081151 | 3300042636 | Bacteria | 4629 |
| 128 | Ga0466703_390787 | 3300042636 | Bacteria | 9767 |
| 129 | Ga0466724_59260 | 3300042649 | Bacteria | 2408 |
| 130 | Ga0466725_132494 | 3300042654 | Bacteria | 1584 |
| 131 | Ga0466715_226702 | 3300042616 | Bacteria | 1941 |
| 132 | Ga0466715_386761 | 3300042616 | Bacteria | 3027 |
| 133 | Ga0466718_019449 | 3300042617 | Bacteria | 2528 |
| 134 | JGI24702J35022_10031146 | 3300002462 | Bacteria | 2859 |
| 135 | Ga0233288_1000826 | 3300022232 | Bacteria | 1859 |
| 136 | Ga0466690_002461 | 3300042590 | Bacteria | 1554 |
| 137 | Ga0466691_101642 | 3300042593 | Bacteria | 14047 |
| 138 | Ga0466696_416208 | 3300042596 | Bacteria | 3908 |
| 139 | Ga0123357_10033422 | 3300009784 | Bacteria | 6988 |
| 140 | Ga0123357_10176287 | 3300009784 | Bacteria | 2512 |
| 141 | Ga0123356_10083617 | 3300010049 | Bacteria | 3024 |
| 142 | Ga0123356_10088717 | 3300010049 | Bacteria | 2941 |
| 143 | Ga0123356_10120018 | 3300010049 | Bacteria | 2555 |
| 144 | Ga0123356_10146608 | 3300010049 | Bacteria | 2336 |
| 145 | Ga0123353_10349093 | 3300010167 | Bacteria | 2230 |
| 146 | Ga0123354_10190846 | 3300010882 | Bacteria | 2295 |
| 147 | Ga0466717_241834 | 3300042604 | Bacteria | 2484 |
| 148 | Ga0466716_049669 | 3300042605 | Unclassified | 2019 |
| 149 | Ga0466698_173983 | 3300042610 | Bacteria | 1884 |
| 150 | Ga0466731_394131 | 3300042622 | Bacteria | 1700 |
| 151 | Ga0466731_396580 | 3300042622 | Bacteria | 2913 |
| 152 | Ga0466734_135802 | 3300042623 | Bacteria | 1492 |
| 153 | Ga0466725_254104 | 3300042654 | Bacteria | 2105 |
| 154 | Ga0466710_238454 | 3300042613 | Bacteria | 1994 |
| 155 | Ga0466726_007004 | 3300042619 | Bacteria | 5886 |
| 156 | Ga0466726_045175 | 3300042619 | Bacteria | 2037 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300042611 | Ga0466697_176146 | Ga0466697_176146_51_1163 | 370 |
| 2 | 3300010882 | Ga0123354_10176083 | Ga0123354_101760832 | 381 |
| 3 | 3300010167 | Ga0123353_10475210 | Ga0123353_104752101 | 383 |
| 4 | 3300042655 | Ga0466727_102173 | Ga0466727_102173_110_1390 | 385 |
| 5 | 3300010167 | Ga0123353_10349579 | Ga0123353_103495791 | 387 |
| 6 | 3300042606 | Ga0466719_363700 | Ga0466719_363700_16553_17716 | 387 |
| 7 | 3300042606 | Ga0466719_290769 | Ga0466719_290769_895_2073 | 392 |
| 8 | 3300042616 | Ga0466715_160426 | Ga0466715_160426_2482_3660 | 392 |
| 9 | 3300042615 | Ga0466711_094111 | Ga0466711_094111_2359_3576 | 393 |
| 10 | 3300002462 | JGI24702J35022_10039106 | JGI24702J35022_100391062 | 394 |
| 11 | 3300042636 | Ga0466703_390787 | Ga0466703_390787_388_1572 | 394 |
| 12 | 3300000062 | IMNBL1DRAFT_c0030017 | IMNBL1DRAFT_00300172 | 395 |
| 13 | 3300042619 | Ga0466726_257225 | Ga0466726_257225_676_1893 | 395 |
| 14 | 3300010049 | Ga0123356_10088717 | Ga0123356_100887172 | 396 |
| 15 | 3300042612 | Ga0466705_217718 | Ga0466705_217718_2505_3695 | 396 |
| 16 | 3300042612 | Ga0466705_481660 | Ga0466705_481660_474_1664 | 396 |
| 17 | 3300042636 | Ga0466703_370519 | Ga0466703_370519_104_1294 | 396 |
| 18 | 3300042643 | Ga0466704_057916 | Ga0466704_057916_3008_4198 | 396 |
| 19 | 3300042619 | Ga0466726_157865 | Ga0466726_157865_28_1227 | 399 |
| 20 | 3300042619 | Ga0466726_455201 | Ga0466726_455201_241_1440 | 399 |
| 21 | 3300042622 | Ga0466731_396580 | Ga0466731_396580_747_1946 | 399 |
| 22 | 3300010049 | Ga0123356_10174836 | Ga0123356_101748363 | 400 |
| 23 | 3300042592 | Ga0466693_050104 | Ga0466693_050104_234_1436 | 400 |
| 24 | 3300042592 | Ga0466693_263333 | Ga0466693_263333_64_1266 | 400 |
| 25 | 3300042598 | Ga0466701_042074 | Ga0466701_042074_215_1417 | 400 |
| 26 | 3300042621 | Ga0466729_118540 | Ga0466729_118540_256_1458 | 400 |
| 27 | 3300010167 | Ga0123353_10318169 | Ga0123353_103181692 | 402 |
| 28 | 3300042654 | Ga0466725_082128 | Ga0466725_082128_1574_2896 | 402 |
| 29 | 3300005083 | Ga0068305_10024903 | Ga0068305_100249031 | 403 |
| 30 | 3300042591 | Ga0466692_101710 | Ga0466692_101710_483_1754 | 404 |
| 31 | 3300042623 | Ga0466734_135802 | Ga0466734_135802_25_1242 | 405 |
| 32 | 3300042655 | Ga0466727_016613 | Ga0466727_016613_35_1252 | 405 |
| 33 | 3300010167 | Ga0123353_10582859 | Ga0123353_105828592 | 406 |
| 34 | 3300005201 | Ga0072941_1143039 | Ga0072941_11430391 | 407 |
| 35 | 3300038395 | Ga0415639_199937 | Ga0415639_199937_21_1301 | 413 |
| 36 | 3300042610 | Ga0466698_173983 | Ga0466698_173983_331_1611 | 414 |
| 37 | 3300002462 | JGI24702J35022_10036851 | JGI24702J35022_100368512 | 415 |
| 38 | 3300010167 | Ga0123353_10349093 | Ga0123353_103490932 | 418 |
| 39 | 3300042592 | Ga0466693_383690 | Ga0466693_383690_660_1976 | 418 |
| 40 | 3300042606 | Ga0466719_502883 | Ga0466719_502883_83_1390 | 418 |
| 41 | 3300042616 | Ga0466715_226702 | Ga0466715_226702_464_1834 | 419 |
| 42 | 3300042606 | Ga0466719_558465 | Ga0466719_558465_98_1402 | 420 |
| 43 | 3300042654 | Ga0466725_132494 | Ga0466725_132494_116_1405 | 420 |
| 44 | 3300002450 | JGI24695J34938_10043812 | JGI24695J34938_100438122 | 422 |
| 45 | 3300042550 | Ga0466656_321774 | Ga0466656_321774_329_1639 | 423 |
| 46 | 3300042623 | Ga0466734_108691 | Ga0466734_108691_195_1511 | 423 |
| 47 | 3300002462 | JGI24702J35022_10052201 | JGI24702J35022_100522013 | 425 |
| 48 | 3300009826 | Ga0123355_10280619 | Ga0123355_102806191 | 425 |
| 49 | 3300021190 | Ga0222431_1000295 | Ga0222431_10002951 | 426 |
| 50 | 3300038395 | Ga0415639_009597 | Ga0415639_009597_111_1391 | 426 |
| 51 | 3300042594 | Ga0466694_086491 | Ga0466694_086491_121_1401 | 426 |
| 52 | 3300042596 | Ga0466696_034525 | Ga0466696_034525_1377_2657 | 426 |
| 53 | 3300042602 | Ga0466713_117423 | Ga0466713_117423_765_2153 | 426 |
| 54 | 3300042604 | Ga0466717_233718 | Ga0466717_233718_68_1348 | 426 |
| 55 | 3300042608 | Ga0466721_228208 | Ga0466721_228208_64_1344 | 426 |
| 56 | 3300042612 | Ga0466705_499938 | Ga0466705_499938_730_2010 | 426 |
| 57 | 3300042613 | Ga0466710_238454 | Ga0466710_238454_131_1411 | 426 |
| 58 | 3300042614 | Ga0466712_046281 | Ga0466712_046281_38_1318 | 426 |
| 59 | 3300042617 | Ga0466718_019449 | Ga0466718_019449_115_1395 | 426 |
| 60 | 3300042619 | Ga0466726_007004 | Ga0466726_007004_3981_5261 | 426 |
| 61 | 3300042622 | Ga0466731_124081 | Ga0466731_124081_1406_2686 | 426 |
| 62 | 3300042636 | Ga0466703_368667 | Ga0466703_368667_1016_2296 | 426 |
| 63 | 3300000089 | AustNasuHG_c1023278 | AustNasuHG_10232783 | 427 |
| 64 | 3300002449 | JGI24698J34947_10061371 | JGI24698J34947_100613712 | 427 |
| 65 | 3300010049 | Ga0123356_10120018 | Ga0123356_101200182 | 427 |
| 66 | 3300010167 | Ga0123353_10426439 | Ga0123353_104264391 | 427 |
| 67 | 3300010167 | Ga0123353_10426832 | Ga0123353_104268321 | 427 |
| 68 | 3300010167 | Ga0123353_10432958 | Ga0123353_104329581 | 427 |
| 69 | 3300042612 | Ga0466705_216979 | Ga0466705_216979_552_1835 | 427 |
| 70 | 3300022815 | Ga0255786_1003222 | Ga0255786_10032221 | 429 |
| 71 | 3300042606 | Ga0466719_153173 | Ga0466719_153173_565_1881 | 429 |
| 72 | 3300042643 | Ga0466704_412806 | Ga0466704_412806_3674_5011 | 429 |
| 73 | 3300038395 | Ga0415639_083860 | Ga0415639_083860_119_1438 | 431 |
| 74 | 3300042590 | Ga0466690_002461 | Ga0466690_002461_190_1485 | 431 |
| 75 | 3300042593 | Ga0466691_101642 | Ga0466691_101642_1653_2948 | 431 |
| 76 | 3300042619 | Ga0466726_064029 | Ga0466726_064029_436_1731 | 431 |
| 77 | 3300042622 | Ga0466731_394131 | Ga0466731_394131_108_1403 | 431 |
| 78 | 3300042590 | Ga0466690_136494 | Ga0466690_136494_411_1709 | 432 |
| 79 | 3300042643 | Ga0466704_131410 | Ga0466704_131410_94_1392 | 432 |
| 80 | 3300042613 | Ga0466710_439388 | Ga0466710_439388_465_1769 | 434 |
| 81 | 3300042636 | Ga0466703_081151 | Ga0466703_081151_1034_2338 | 434 |
| 82 | 2225789004 | 2227622690 | 2228202402 | 435 |
| 83 | 3300022232 | Ga0233288_1000826 | Ga0233288_10008262 | 435 |
| 84 | 3300022232 | Ga0233288_1013353 | Ga0233288_10133532 | 435 |
| 85 | 3300042582 | Ga0466657_038373 | Ga0466657_038373_693_2000 | 435 |
| 86 | 3300042611 | Ga0466697_228472 | Ga0466697_228472_1661_2968 | 435 |
| 87 | 3300042612 | Ga0466705_163778 | Ga0466705_163778_558_1865 | 435 |
| 88 | 3300042612 | Ga0466705_328506 | Ga0466705_328506_140_1447 | 435 |
| 89 | 3300042619 | Ga0466726_005480 | Ga0466726_005480_768_2075 | 435 |
| 90 | 3300042652 | Ga0466708_124976 | Ga0466708_124976_2707_4014 | 435 |
| 91 | iso_pr_bacteria | 2820223845 | 2820226872 | 435 |
| 92 | 3300002462 | JGI24702J35022_10020568 | JGI24702J35022_100205681 | 436 |
| 93 | 3300009784 | Ga0123357_10175487 | Ga0123357_101754872 | 436 |
| 94 | 3300042611 | Ga0466697_158796 | Ga0466697_158796_781_2091 | 436 |
| 95 | 3300002462 | JGI24702J35022_10049415 | JGI24702J35022_100494151 | 437 |
| 96 | 3300002462 | JGI24702J35022_10059799 | JGI24702J35022_100597992 | 437 |
| 97 | 3300042659 | Ga0466733_031130 | Ga0466733_031130_831_2162 | 437 |
| 98 | 3300010167 | Ga0123353_10416649 | Ga0123353_104166491 | 438 |
| 99 | 3300042550 | Ga0466656_012596 | Ga0466656_012596_682_1998 | 438 |
| 100 | 3300042604 | Ga0466717_128514 | Ga0466717_128514_656_1972 | 438 |
| 101 | 3300042608 | Ga0466721_041560 | Ga0466721_041560_685_2001 | 438 |
| 102 | 3300042616 | Ga0466715_386761 | Ga0466715_386761_1073_2389 | 438 |
| 103 | 3300042654 | Ga0466725_132572 | Ga0466725_132572_107_1423 | 438 |
| 104 | 3300002462 | JGI24702J35022_10041064 | JGI24702J35022_100410641 | 439 |
| 105 | 3300005201 | Ga0072941_1023110 | Ga0072941_102311057 | 439 |
| 106 | 3300009784 | Ga0123357_10033422 | Ga0123357_100334222 | 439 |
| 107 | 3300009784 | Ga0123357_10131214 | Ga0123357_101312143 | 439 |
| 108 | 3300009784 | Ga0123357_10225249 | Ga0123357_102252493 | 439 |
| 109 | 3300010049 | Ga0123356_10070158 | Ga0123356_100701582 | 439 |
| 110 | 3300010049 | Ga0123356_10083617 | Ga0123356_100836173 | 439 |
| 111 | 3300010049 | Ga0123356_10201018 | Ga0123356_102010181 | 439 |
| 112 | 3300042592 | Ga0466693_262982 | Ga0466693_262982_172_1491 | 439 |
| 113 | 3300042600 | Ga0466700_115699 | Ga0466700_115699_708_2027 | 439 |
| 114 | 3300042611 | Ga0466697_092052 | Ga0466697_092052_1048_2367 | 439 |
| 115 | 3300042613 | Ga0466710_319379 | Ga0466710_319379_825_2144 | 439 |
| 116 | 3300042649 | Ga0466724_59260 | Ga0466724_59260_801_2120 | 439 |
| 117 | 3300042654 | Ga0466725_043598 | Ga0466725_043598_242_1561 | 439 |
| 118 | 3300042654 | Ga0466725_105224 | Ga0466725_105224_80_1399 | 439 |
| 119 | 3300042654 | Ga0466725_452334 | Ga0466725_452334_111_1430 | 439 |
| 120 | 3300009784 | Ga0123357_10118697 | Ga0123357_101186973 | 440 |
| 121 | 3300009826 | Ga0123355_10253905 | Ga0123355_102539052 | 440 |
| 122 | 3300009826 | Ga0123355_10311584 | Ga0123355_103115841 | 440 |
| 123 | 3300010049 | Ga0123356_10146608 | Ga0123356_101466082 | 440 |
| 124 | 3300010049 | Ga0123356_10171314 | Ga0123356_101713142 | 440 |
| 125 | 3300010049 | Ga0123356_10186326 | Ga0123356_101863261 | 440 |
| 126 | 3300010049 | Ga0123356_10227745 | Ga0123356_102277451 | 440 |
| 127 | 3300010049 | Ga0123356_10337286 | Ga0123356_103372861 | 440 |
| 128 | 3300010167 | Ga0123353_10226007 | Ga0123353_102260071 | 440 |
| 129 | 3300010167 | Ga0123353_10271517 | Ga0123353_102715171 | 440 |
| 130 | 3300010882 | Ga0123354_10190846 | Ga0123354_101908463 | 440 |
| 131 | 3300024493 | Ga0264413_146675 | Ga0264413_1466751 | 440 |
| 132 | 3300042582 | Ga0466657_349902 | Ga0466657_349902_625_1947 | 440 |
| 133 | 3300042604 | Ga0466717_241834 | Ga0466717_241834_959_2281 | 440 |
| 134 | 3300042612 | Ga0466705_395162 | Ga0466705_395162_4052_5374 | 440 |
| 135 | 3300002462 | JGI24702J35022_10031146 | JGI24702J35022_100311462 | 441 |
| 136 | 3300009784 | Ga0123357_10163790 | Ga0123357_101637902 | 441 |
| 137 | 3300009826 | Ga0123355_10329869 | Ga0123355_103298691 | 441 |
| 138 | 3300010049 | Ga0123356_10215428 | Ga0123356_102154281 | 442 |
| 139 | 3300042601 | Ga0466707_252800 | Ga0466707_252800_329_1723 | 442 |
| 140 | 3300010882 | Ga0123354_10244248 | Ga0123354_102442482 | 445 |
| 141 | 3300042621 | Ga0466729_286458 | Ga0466729_286458_137_1477 | 446 |
| 142 | 3300042619 | Ga0466726_045175 | Ga0466726_045175_237_1706 | 448 |
| 143 | 3300010049 | Ga0123356_10122906 | Ga0123356_101229062 | 449 |
| 144 | 3300010049 | Ga0123356_10187126 | Ga0123356_101871261 | 449 |
| 145 | 3300042590 | Ga0466690_134625 | Ga0466690_134625_947_2296 | 449 |
| 146 | 3300042654 | Ga0466725_254104 | Ga0466725_254104_504_1901 | 449 |
| 147 | 3300009784 | Ga0123357_10176287 | Ga0123357_101762873 | 454 |
| 148 | 3300010167 | Ga0123353_10139176 | Ga0123353_101391763 | 457 |
| 149 | 3300042550 | Ga0466656_045378 | Ga0466656_045378_94_1494 | 458 |
| 150 | 3300042622 | Ga0466731_038324 | Ga0466731_038324_541_1929 | 462 |
| 151 | 3300010049 | Ga0123356_10142090 | Ga0123356_101420901 | 463 |
| 152 | 3300010167 | Ga0123353_10301081 | Ga0123353_103010812 | 472 |
| 153 | 3300010167 | Ga0123353_10218900 | Ga0123353_102189003 | 473 |
| 154 | 3300042596 | Ga0466696_416208 | Ga0466696_416208_225_1652 | 475 |
| 155 | 3300042612 | Ga0466705_043049 | Ga0466705_043049_1452_2879 | 475 |
| 156 | 3300010167 | Ga0123353_10017286 | Ga0123353_100172869 | 478 |
| 157 | 3300042605 | Ga0466716_049669 | Ga0466716_049669_58_1497 | 479 |
Functional Annotation
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.81 | 0.86 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.