Protein Family IF06282

Metagenome Isolate
224 Members
111 Samples
173 Scaffolds
294.86 Avg Length

🧬 Representative Sequence

ID
3300042604|Ga0466717_259684|Ga0466717_259684_1083_2141
Length
352 aa
Sequence
MTVIKLMGRYRVDIRFDTIMPAPQGRRFYVHTAAGRKPLPGCMRSFRAHSRPKKEEKMAIFKGAGVAIITPFHQDFSVDYEKLAELIEFQVNGSTDAIIICGTTGEASTLSHDEHLAVVRFAVKTVAGRIPVIAGTGSNCTETAVHLSQEAEKAGVDGILVVNPYYNKATQKGLYEHYKLIAEGVKIPLIIYNVPSRTGQNILPQTIASLVHDVPNIVGVKEASGDLAQIAMLMHLTNGEIDLYAGNDDIIIPVLALGGIGVISVTSNLAPRQTHEICQKFFDGDLSGSSKMFLDTIPLVAALFCEVSPTPVKKALNLMGKYNGVLRRPLIEMEAQNVPKLEKAMREYGLLS

📊 Sample Types

Isolate 22.8%
Metagenome 77.2%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 30.3%
Termitidae 25.7%
Blattidae 12.8%
Kalotermitidae 11.9%
Drosophilidae 5.5%
Rhinotermitidae 2.8%
Passalidae 2.8%
Termopsidae 2.8%
Curculionidae 2.8%
Pentatomidae 0.9%
Hodotermitidae 0.9%
Tenebrionidae 0.9%

🌳 Taxonomy

Archaea 0
Bacteria 218
Eukaryota 0
Viruses 0
Unclassified 6

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820596822 Unclassified Firmicutes Emb289P1bin58 Isolate Unclassified
2 2820671341 Unclassified Firmicutes Co191P3bin20 Isolate Unclassified
3 2940286528 Lachnospiraceae bacterium PFB1-21 Isolate Blattidae
4 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
5 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
6 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
7 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
8 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
9 2820229114 Unclassified Firmicutes Th196P4bin40 Isolate Unclassified
10 2820280018 Unclassified Firmicutes Th196P3bin149 Isolate Unclassified
11 2820492969 Unclassified Firmicutes Lab288P1bin6 Isolate Unclassified
12 2820516196 Unclassified Firmicutes Lab288P1bin3 Isolate Unclassified
13 2820520043 Unclassified Firmicutes Lab288P1bin24 Isolate Unclassified
14 2820613375 Unclassified Firmicutes Emb289P1bin134 Isolate Unclassified
15 2820705605 Unclassified Firmicutes Co191P1bin34 Isolate Unclassified
16 2820032565 Unclassified Saccharibacteria Th196P3bin19 Isolate Unclassified
17 2820406809 Unclassified Firmicutes Lab288P4bin87 Isolate Unclassified
18 2940230426 Lachnospiraceae bacterium PH5-48 Isolate Blattidae
19 2940283334 Lachnospiraceae bacterium PF1-4 Isolate Blattidae
20 2940295490 Lachnospiraceae bacterium PH1-22 Isolate Blattidae
21 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
22 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
23 8062647588 Nissabacter archeti JGM97 Isolate Drosophilidae
24 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
25 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
26 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
27 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
28 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
29 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
30 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
31 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
32 3300007130 Drosophila gut microbial communities from New York, USA - Drosophila falleni male 4 gut Metagenome Drosophilidae
33 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
34 2820277137 Unclassified Firmicutes Th196P3bin150 Isolate Unclassified
35 2820282995 Unclassified Firmicutes Th196P3bin147 Isolate Unclassified
36 2820362221 Unclassified Firmicutes Nt197P3bin116 Isolate Unclassified
37 2837516909 Rahnella bruchi DSM 27398 Isolate Unclassified
38 2940270707 Lachnoclostridium sp. PF1-13 Isolate Blattidae
39 2820931684 Unclassified Actinobacteria Emb289P1bin89 Isolate Unclassified
40 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
41 2593339124 Clostridium sp. 4 Isolate Termitidae
42 2820360414 Unclassified Firmicutes Nt197P3bin121 Isolate Unclassified
43 2820474468 Unclassified Firmicutes Lab288P1bin84 Isolate Unclassified
44 2846386538 Rahnella sp. AN3-3W3 Isolate Pentatomidae
45 2940273867 Lachnoclostridium sp. PH1-16 Isolate Blattidae
46 2940289514 Lachnospiraceae bacterium PM6-15 Isolate Blattidae
47 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
48 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
49 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
50 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
51 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
52 3300002501 Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 Metagenome Termitidae
53 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
54 3300005306 Drosophila gut microbial communities from New York, USA - Drosophila neotestacea female 1 gut Metagenome Drosophilidae
55 3300007505 Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut Metagenome Drosophilidae
56 2065487013 Fungus-growing termite worker microbial communities from South Africa - Oerleman's Farm Metagenome
57 2820495292 Unclassified Firmicutes Lab288P1bin59 Isolate Unclassified
58 2820626145 Unclassified Firmicutes Emb289P1bin123 Isolate Unclassified
59 2940264388 Lachnospiraceae bacterium PFB1-17 Isolate Blattidae
60 2940267548 Lachnospiraceae bacterium PFB1-22 Isolate Blattidae
61 2940280053 Lachnospiraceae bacterium PF1-22 Isolate Blattidae
62 2944625312 Dysgonomonas sp. PF1-3 Isolate Blattidae
63 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
64 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
65 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
66 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
67 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
68 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
69 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
70 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
71 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
72 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
73 2593339125 Clostridium sp. 5 Isolate Termitidae
74 2636416028 Pelosinus propionicus DSM 13327 Isolate Unclassified
75 2820646798 Unclassified Firmicutes Cu122P5bin36 Isolate Unclassified
76 2835335304 Rahnella sp. Larv3_ips Isolate Curculionidae
77 2940233634 Lachnoclostridium sp. PF5-10 Isolate Blattidae
78 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
79 2989309576 Sporomusa termitida DSM 4440 Isolate Unclassified
80 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
81 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
82 2590828840 Clostridium sp. 2 Isolate Termitidae
83 2820488713 Unclassified Firmicutes Lab288P1bin69 Isolate Unclassified
84 2820507989 Unclassified Firmicutes Lab288P1bin41 Isolate Unclassified
85 2820512088 Unclassified Firmicutes Lab288P1bin4 Isolate Unclassified
86 2820533259 Unclassified Firmicutes Lab288P1bin140 Isolate Unclassified
87 2820584674 Unclassified Firmicutes Emb289P1bin98 Isolate Unclassified
88 2940292506 Lachnoclostridium sp. PH5-23 Isolate Blattidae
89 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
90 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
91 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
92 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
93 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
94 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
95 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
96 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
97 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
98 3300007149 Drosophila gut microbial communities from New York, USA - Drosophila falleni female 4 gut Metagenome Drosophilidae
99 2035918003 Mountain Pine Beetle microbial communities from McBride, British Columbia, Canada - Lodgepole pine Metagenome Curculionidae
100 2225789003 Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) Metagenome Passalidae
101 2820240463 Unclassified Firmicutes Th196P3bin85 Isolate Unclassified
102 2820267566 Unclassified Firmicutes Th196P3bin33 Isolate Unclassified
103 2940277027 Lachnospiraceae bacterium PF1-21 Isolate Blattidae
104 3300056856 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) Metagenome Tenebrionidae
105 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
106 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
107 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
108 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
109 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
110 3300003973 Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle Metagenome Curculionidae
111 3300007106 Drosophila gut microbial communities from New York, USA - Drosophila falleni male 3 gut Metagenome Drosophilidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466733_133858 3300042659 Bacteria 6783
2 Ga0562375_2332 3300056856 Bacteria 21520
3 Ga0466701_028686 3300042598 Bacteria 2997
4 Ga0466706_158567 3300042599 Bacteria 30537
5 Ga0466706_173612 3300042599 Bacteria 5551
6 Ga0466706_177658 3300042599 Unclassified 5718
7 Ga0466707_241097 3300042601 Bacteria 4147
8 Ga0466707_340158 3300042601 Bacteria 3512
9 Ga0466713_073679 3300042602 Bacteria 72784
10 Ga0466713_137279 3300042602 Unclassified 7150
11 Ga0466714_098456 3300042603 Bacteria 1122
12 Ga0466716_427612 3300042605 Bacteria 9499
13 Ga0466719_269104 3300042606 Bacteria 15813
14 Ga0466704_468700 3300042643 Bacteria 2793
15 Ga0123355_10000370 3300009826 Bacteria 58074
16 Ga0123355_10006672 3300009826 Bacteria 17160
17 Ga0123355_10081125 3300009826 Bacteria 5177
18 Ga0123355_10107425 3300009826 Bacteria 4372
19 Ga0123355_10189881 3300009826 Bacteria 3028
20 Ga0123353_10000639 3300010167 Bacteria 42789
21 Ga0123353_10111527 3300010167 Bacteria 4405
22 2227000114 2225789003 Bacteria 1347
23 2227358543 2225789004 Bacteria 130700
24 IMNBL1DRAFT_c0001064 3300000062 Bacteria 21175
25 JGI24695J34938_10006036 3300002450 Bacteria 7387
26 JGI24705J35276_12230352 3300002504 Bacteria 3607
27 Ga0104041_1000253 3300007106 Bacteria 11755
28 Ga0466733_052837 3300042659 Bacteria 8602
29 Ga0415639_167887 3300038395 Bacteria 1277
30 Ga0466692_173925 3300042591 Bacteria 105430
31 Ga0466691_212677 3300042593 Bacteria 4994
32 Ga0466696_375600 3300042596 Bacteria 8621
33 Ga0466707_080023 3300042601 Bacteria 16518
34 Ga0466721_275466 3300042608 Bacteria 134922
35 Ga0466722_234024 3300042609 Bacteria 4730
36 Ga0466698_107576 3300042610 Bacteria 7004
37 Ga0466715_645092 3300042616 Bacteria 14742
38 Ga0466735_105457 3300042624 Bacteria 3348
39 Ga0466702_284954 3300042635 Bacteria 1938
40 Ga0466702_311100 3300042635 Bacteria 5154
41 Ga0466703_144979 3300042636 Bacteria 4611
42 Ga0466703_334483 3300042636 Bacteria 67687
43 Ga0123357_10215037 3300009784 Bacteria 2148
44 Ga0123355_10013326 3300009826 Bacteria 12787
45 Ga0123355_10016048 3300009826 Bacteria 11789
46 Ga0123356_10001092 3300010049 Bacteria 30038
47 Ga0123356_10922735 3300010049 Bacteria 1044
48 Ga0123353_10176507 3300010167 Bacteria 3387
49 Ga0123353_10228224 3300010167 Bacteria 2905
50 Ga0123353_10658997 3300010167 Bacteria 1480
51 FGTW_contig30408 2065487013 Bacteria 95193
52 2227646814 2225789004 Bacteria 44642
53 AustNasuHG_c1017443 3300000089 Bacteria 2388
54 Ga0415639_001305 3300038395 Bacteria 6829
55 Ga0415639_069395 3300038395 Bacteria 8055
56 Ga0415639_285632 3300038395 Bacteria 1187
57 Ga0466690_176469 3300042590 Bacteria 1688
58 Ga0466706_202476 3300042599 Bacteria 1841
59 Ga0466707_176737 3300042601 Bacteria 29441
60 Ga0466715_232897 3300042616 Bacteria 4382
61 Ga0466715_483797 3300042616 Bacteria 58432
62 Ga0466726_036168 3300042619 Bacteria 7698
63 Ga0466731_121509 3300042622 Bacteria 1703
64 Ga0466704_322452 3300042643 Bacteria 3769
65 Ga0123355_10002050 3300009826 Bacteria 28456
66 Ga0123355_10338348 3300009826 Bacteria 2008
67 Ga0123356_10334413 3300010049 Bacteria 1633
68 Ga0123353_10012808 3300010167 Bacteria 11959
69 Ga0123353_10230697 3300010167 Bacteria 2886
70 Ga0104042_1000074 3300007130 Bacteria 3897
71 Ga0105005_1039310 3300007505 Bacteria 18208
72 Ga0466733_198528 3300042659 Bacteria 1043
73 Ga0466693_164074 3300042592 Bacteria 1339
74 Ga0466701_046500 3300042598 Bacteria 4206
75 Ga0466706_122429 3300042599 Bacteria 70491
76 Ga0466713_039178 3300042602 Bacteria 205362
77 Ga0466714_167736 3300042603 Bacteria 6470
78 Ga0466717_259684 3300042604 Bacteria 3264
79 Ga0466722_238835 3300042609 Bacteria 15611
80 Ga0466724_58988 3300042649 Bacteria 3529
81 Ga0123355_10051651 3300009826 Bacteria 6671
82 Ga0123355_10386067 3300009826 Bacteria 1820
83 Ga0123355_10579266 3300009826 Bacteria 1342
84 Ga0123356_10019151 3300010049 Bacteria 6490
85 Ga0123353_10516934 3300010167 Bacteria 1734
86 Ga0123354_10000235 3300010882 Bacteria 49650
87 DPOL_contig00086 2035918003 Bacteria 93085
88 IMNBL1DRAFT_c0000220 3300000062 Bacteria 49966
89 IMNBL1DRAFT_c0000460 3300000062 Bacteria 34038
90 Ga0068305_10002195 3300005083 Unclassified 25614
91 Ga0466706_167016 3300042599 Bacteria 1528
92 Ga0466700_466547 3300042600 Bacteria 1070
93 Ga0466698_169800 3300042610 Bacteria 3375
94 Ga0466697_042420 3300042611 Bacteria 1383
95 Ga0466715_483763 3300042616 Bacteria 20073
96 Ga0466702_237244 3300042635 Bacteria 1264
97 Ga0466702_324890 3300042635 Bacteria 1295
98 Ga0466702_443794 3300042635 Bacteria 10333
99 Ga0466703_257786 3300042636 Bacteria 52276
100 Ga0466727_164564 3300042655 Bacteria 1823
101 Ga0123355_10002027 3300009826 Bacteria 28645
102 Ga0123356_10001381 3300010049 Bacteria 26901
103 Ga0123356_10065942 3300010049 Bacteria 3389
104 Ga0123356_10207810 3300010049 Bacteria 2003
105 Ga0123354_10041469 3300010882 Bacteria 7114
106 2227541878 2225789004 Bacteria 2977
107 JGI24695J34938_10024803 3300002450 Bacteria 2876
108 JGI24703J35330_11689259 3300002501 Bacteria 1889
109 Ga0063521_1000344 3300003973 Bacteria 26815
110 Ga0063521_1000553 3300003973 Bacteria 16365
111 Ga0072941_1224194 3300005201 Bacteria 5216
112 Ga0466706_046179 3300042599 Bacteria 2005
113 Ga0466706_107466 3300042599 Bacteria 2521
114 Ga0466706_135485 3300042599 Bacteria 1794
115 Ga0466700_331316 3300042600 Bacteria 9353
116 Ga0466713_117950 3300042602 Bacteria 2605
117 Ga0466719_453084 3300042606 Unclassified 4215
118 Ga0466728_016388 3300042620 Bacteria 40038
119 Ga0466729_262899 3300042621 Bacteria 3153
120 Ga0466731_350380 3300042622 Bacteria 1450
121 Ga0466703_222245 3300042636 Bacteria 3118
122 Ga0466703_343670 3300042636 Bacteria 7335
123 Ga0466704_103189 3300042643 Bacteria 58965
124 Ga0466709_368918 3300042648 Bacteria 82197
125 Ga0466708_400696 3300042652 Bacteria 9245
126 Ga0466725_203071 3300042654 Bacteria 3490
127 Ga0123355_10039386 3300009826 Bacteria 7689
128 Ga0123355_10351298 3300009826 Bacteria 1953
129 Ga0123353_10003607 3300010167 Bacteria 19609
130 Ga0123353_10225906 3300010167 Bacteria 2923
131 Ga0123353_10306085 3300010167 Bacteria 2422
132 2227141924 2225789004 Bacteria 8712
133 JGI24702J35022_10004279 3300002462 Bacteria 8515
134 JGI24705J35276_12238662 3300002504 Bacteria 33887
135 Ga0068305_10234975 3300005083 Bacteria 2525
136 Ga0072941_1096920 3300005201 Bacteria 13635
137 Ga0466705_278053 3300042612 Bacteria 68368
138 Ga0466733_025719 3300042659 Bacteria 1715
139 Ga0415639_066400 3300038395 Bacteria 7532
140 Ga0466706_053647 3300042599 Bacteria 2370
141 Ga0466706_067808 3300042599 Bacteria 2155
142 Ga0466706_102143 3300042599 Bacteria 1541
143 Ga0466706_201942 3300042599 Bacteria 17932
144 Ga0466719_133332 3300042606 Bacteria 2078
145 Ga0466726_471877 3300042619 Bacteria 27246
146 Ga0466702_116525 3300042635 Bacteria 1112
147 Ga0466703_324489 3300042636 Bacteria 3903
148 Ga0123355_10015861 3300009826 Bacteria 11852
149 Ga0123355_10086216 3300009826 Bacteria 4994
150 Ga0123355_10197627 3300009826 Bacteria 2945
151 Ga0123356_10207402 3300010049 Bacteria 2005
152 Ga0123353_10021843 3300010167 Bacteria 9621
153 JGI24702J35022_10000376 3300002462 Bacteria 26483
154 Ga0068305_10005230 3300005083 Bacteria 6754
155 Ga0466693_359963 3300042592 Unclassified 1597
156 Ga0466706_194038 3300042599 Bacteria 6197
157 Ga0466706_207135 3300042599 Bacteria 19890
158 Ga0466716_369381 3300042605 Bacteria 29324
159 Ga0466716_480508 3300042605 Bacteria 2201
160 Ga0466697_042804 3300042611 Bacteria 1502
161 Ga0466705_396447 3300042612 Unclassified 1147
162 Ga0466711_257953 3300042615 Bacteria 3689
163 Ga0466703_093453 3300042636 Bacteria 24885
164 Ga0466709_374255 3300042648 Bacteria 116572
165 Ga0123357_10387441 3300009784 Bacteria 1289
166 Ga0123355_10042405 3300009826 Bacteria 7407
167 Ga0123353_10205495 3300010167 Bacteria 3094
168 IMNBL1DRAFT_c0000009 3300000062 Bacteria 243341
169 IMNBL1DRAFT_c0000060 3300000062 Bacteria 101547
170 IMNBL1DRAFT_c0000484 3300000062 Bacteria 33175
171 JGI24696J40584_12925915 3300002834 Bacteria 1406
172 Ga0074303_1074379 3300005306 Bacteria 4245
173 Ga0104040_1041310 3300007149 Bacteria 7742

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00701 DHDPS Dihydrodipicolinate synthetase family 61 346 0.99

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF00701 GO:0016829 lyase activity MF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.