Protein Family IF06173
Metagenome
Isolate
375
Members
119
Samples
331
Scaffolds
196.35
Avg Length
Representative Sequence
- ID
- 3300042603|Ga0466714_013796|Ga0466714_013796_1695_2405
- Length
- 236 aa
- Sequence
- MLLYEKLNPYRIILASGSPRRRQLLKDAGIAYELAEGYEVEEVFPASLPVEQVPVYLSELKSAAYPNELSSKEILITADTVVCLHGALIGKPEDRADAVAILGRLSANRHTVVTGVTLRTAGRKKSFSVHSDVFFRKLTGEEIDWYVDTYRPFDKAGAYGVQEWIGYVGIERIEGSFYNVMGLPVQRLYLELDEFLAAFTQNNGEEMNNLDAIIAVGHSPAGAISSFLYGCRPFGA
Sample Types
Isolate
11.7%
Metagenome
88.3%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
25.5%
Blattidae
20.0%
Unclassified
12.7%
Kalotermitidae
12.7%
Formicidae
8.2%
Drosophilidae
5.5%
Rhinotermitidae
3.6%
Termopsidae
3.6%
Armadillidiidae
2.7%
Passalidae
1.8%
Hodotermitidae
0.9%
Cambaridae
0.9%
Bombycidae
0.9%
Tenebrionidae
0.9%
Taxonomy
Archaea
1
Bacteria
361
Eukaryota
0
Viruses
0
Unclassified
13
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820759988 | Unclassified Bacteroidetes Mp193P4bin4 | Isolate | Unclassified |
| 2 | 2882250448 | Bizionia sp. APA-3 | Isolate | |
| 3 | 2923982719 | Parabacteroides sp. 52 | Isolate | Blattidae |
| 4 | 2940306115 | Parabacteroides sp. PFB2-22 | Isolate | Blattidae |
| 5 | 2940309933 | Parabacteroides sp. PH5-13 | Isolate | Blattidae |
| 6 | 2940328985 | Parabacteroides sp. PH5-46 | Isolate | Blattidae |
| 7 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 8 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 9 | 3300007080 | Ant gut microbial communities from Cephalotes clypeatus, Brazil | Metagenome | Formicidae |
| 10 | 3300007153 | Drosophila gut microbial communities from New York, USA - Drosophila putrida male 3 gut | Metagenome | Drosophilidae |
| 11 | 3300007190 | Ant gut microbial communities from Cephalotes umbraculatus, Peru | Metagenome | Formicidae |
| 12 | 3300007192 | Ant gut microbial communities from Cephalotes persimplex, Brazil | Metagenome | Formicidae |
| 13 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 14 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 15 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 16 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 17 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 18 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 19 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 20 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 21 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 22 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 23 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 24 | 2894649344 | Allomuricauda alvinocaridis SCR12 | Isolate | Unclassified |
| 25 | 2898741527 | Sphingobacterium sp. xlx-73 | Isolate | |
| 26 | 2904728850 | Flavobacterium sp. xlx-214 | Isolate | |
| 27 | 2940202316 | Parabacteroides sp. PF5-9 | Isolate | Blattidae |
| 28 | 2940371297 | Parabacteroides sp. PM5-20 | Isolate | Blattidae |
| 29 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 30 | 3300007142 | Ant gut microbial communities from Cephalotes grandinosus, Brazil | Metagenome | Formicidae |
| 31 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 32 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 33 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 34 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 35 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 36 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 37 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 38 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 39 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 40 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 41 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 42 | 2940248789 | Dysgonomonas sp. PF1-16 | Isolate | Blattidae |
| 43 | 2958471994 | Flavobacterium sp. xlx-221 | Isolate | Cambaridae |
| 44 | 2579779088 | Sphingobacterium paucimobilis HER1398 | Isolate | Bombycidae |
| 45 | 2820740053 | Unclassified Bacteroidetes Th196P3bin81 | Isolate | Unclassified |
| 46 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 47 | 3300007068 | Ant gut microbial communities from Cephalotes simillimus, Peru | Metagenome | Formicidae |
| 48 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 49 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 50 | 2820768849 | Unclassified Bacteroidetes Lab288P3bin194 | Isolate | Unclassified |
| 51 | 2820774381 | Unclassified Bacteroidetes Lab288P1bin37 | Isolate | Unclassified |
| 52 | 2896321640 | Sphingobacterium sp. xlx-130 | Isolate | |
| 53 | 2899132286 | Myroides albus BIT-d1 | Isolate | Tenebrionidae |
| 54 | 2922326829 | Bacteroides sp. 224 | Isolate | Blattidae |
| 55 | 2940253009 | Dysgonomonas sp. PF1-23 | Isolate | Blattidae |
| 56 | 2940257232 | Dysgonomonas sp. PFB1-18 | Isolate | Blattidae |
| 57 | 2940313741 | Parabacteroides sp. PH5-17 | Isolate | Blattidae |
| 58 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 59 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 60 | 3300007085 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut | Metagenome | Drosophilidae |
| 61 | 3300012824 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG | Metagenome | Armadillidiidae |
| 62 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 63 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 64 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 65 | 2820762746 | Unclassified Bacteroidetes Mp193P4bin3 | Isolate | Unclassified |
| 66 | 2896330536 | Sphingobacterium sp. xlx-96 | Isolate | |
| 67 | 2940205530 | Parabacteroides sp. PH5-33 | Isolate | Blattidae |
| 68 | 2940216256 | Dysgonomonadaceae bacterium PH5-43 | Isolate | Blattidae |
| 69 | 2940317558 | Parabacteroides sp. PH5-26 | Isolate | Blattidae |
| 70 | 2940325180 | Parabacteroides sp. PH5-41 | Isolate | Blattidae |
| 71 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 72 | 2695420931 | Dysgonomonas macrotermitis DSM 27370 | Isolate | Unclassified |
| 73 | 3300007140 | Ant gut microbial communities from Cephalotes pallens, Brazil | Metagenome | Formicidae |
| 74 | 3300007143 | Drosophila gut microbial communities from New York, USA - Drosophila putrida female 3 gut | Metagenome | Drosophilidae |
| 75 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 76 | 3300012858 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG | Metagenome | Armadillidiidae |
| 77 | 2609459943 | Bacteroides reticulotermitis JCM 10512 | Isolate | Rhinotermitidae |
| 78 | 2820744581 | Unclassified Bacteroidetes Th196P3bin138 | Isolate | Unclassified |
| 79 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 80 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 81 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 82 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 83 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 84 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 85 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 86 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 87 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 88 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 89 | 2896350215 | Sphingobacterium sp. xlx-183 | Isolate | |
| 90 | 2940195863 | Parabacteroides sp. PF5-6 | Isolate | Blattidae |
| 91 | 2940298504 | Parabacteroides sp. PF5-13 | Isolate | Blattidae |
| 92 | 2820736622 | Unclassified Bacteroidetes Th196P4bin26 | Isolate | Unclassified |
| 93 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 94 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 95 | 3300007150 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 3 gut | Metagenome | Drosophilidae |
| 96 | 3300007505 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut | Metagenome | Drosophilidae |
| 97 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 98 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 99 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 100 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 101 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 102 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 103 | 2820765201 | Unclassified Bacteroidetes Lab288P3bin82 | Isolate | Unclassified |
| 104 | 2830041218 | Bacteroides reticulotermitis DSM 105720 | Isolate | Unclassified |
| 105 | 2940212447 | Parabacteroides sp. PH5-16 | Isolate | Blattidae |
| 106 | 2940244548 | Dysgonomonas sp. PF1-14 | Isolate | Blattidae |
| 107 | 2940302308 | Parabacteroides sp. PF5-5 | Isolate | Blattidae |
| 108 | 2940321370 | Parabacteroides sp. PH5-39 | Isolate | Blattidae |
| 109 | 2940332795 | Parabacteroides sp. PH5-8 | Isolate | Blattidae |
| 110 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 111 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 112 | 3300005307 | Drosophila gut microbial communities from New York, USA - Drosophila putrida female 1 gut | Metagenome | Drosophilidae |
| 113 | 3300007095 | Ant gut microbial communities from Cephalotes minutus, Brazil | Metagenome | Formicidae |
| 114 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 115 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 116 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 117 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 118 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 119 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | 2227513552 | 2225789004 | Bacteria | 3501 |
| 2 | 2227576578 | 2225789004 | Bacteria | 2555 |
| 3 | IMNBL1DRAFT_c0005969 | 3300000062 | Bacteria | 6805 |
| 4 | IMNBL1DRAFT_c0011476 | 3300000062 | Bacteria | 4134 |
| 5 | JGI24702J35022_10362811 | 3300002462 | Bacteria | 868 |
| 6 | Ga0102740_1000548 | 3300007140 | Bacteria | 10278 |
| 7 | Ga0104050_1002864 | 3300007153 | Bacteria | 4054 |
| 8 | Ga0123354_10005802 | 3300010882 | Bacteria | 18105 |
| 9 | Ga0466733_067642 | 3300042659 | Bacteria | 12444 |
| 10 | Ga0466733_147774 | 3300042659 | Bacteria | 3245 |
| 11 | Ga0466733_209000 | 3300042659 | Bacteria | 10317 |
| 12 | Ga0466701_027194 | 3300042598 | Bacteria | 1506 |
| 13 | Ga0466701_093209 | 3300042598 | Bacteria | 69353 |
| 14 | Ga0466706_154769 | 3300042599 | Bacteria | 8287 |
| 15 | Ga0466706_204359 | 3300042599 | Bacteria | 22058 |
| 16 | Ga0466700_002804 | 3300042600 | Bacteria | 7874 |
| 17 | Ga0466707_291066 | 3300042601 | Bacteria | 10923 |
| 18 | Ga0466713_131527 | 3300042602 | Bacteria | 55397 |
| 19 | Ga0466714_035388 | 3300042603 | Bacteria | 1872 |
| 20 | Ga0466705_461320 | 3300042612 | Bacteria | 10068 |
| 21 | Ga0466711_094091 | 3300042615 | Bacteria | 4686 |
| 22 | Ga0466711_160184 | 3300042615 | Bacteria | 13975 |
| 23 | Ga0466715_383243 | 3300042616 | Unclassified | 3357 |
| 24 | Ga0466723_127458 | 3300042618 | Bacteria | 5164 |
| 25 | Ga0466723_173974 | 3300042618 | Bacteria | 14831 |
| 26 | Ga0466728_064136 | 3300042620 | Bacteria | 50421 |
| 27 | Ga0466728_306930 | 3300042620 | Bacteria | 116996 |
| 28 | Ga0160433_100138 | 3300012846 | Unclassified | 64982 |
| 29 | Ga0265387_1001377 | 3300024582 | Bacteria | 3557 |
| 30 | Ga0466690_053116 | 3300042590 | Bacteria | 3969 |
| 31 | Ga0466693_306053 | 3300042592 | Bacteria | 1196 |
| 32 | Ga0466691_017420 | 3300042593 | Bacteria | 2231 |
| 33 | Ga0466696_502627 | 3300042596 | Archaea | 4358 |
| 34 | Ga0466704_104502 | 3300042643 | Bacteria | 10368 |
| 35 | Ga0466704_364071 | 3300042643 | Bacteria | 2459 |
| 36 | Ga0466708_065430 | 3300042652 | Bacteria | 25041 |
| 37 | Ga0466727_263308 | 3300042655 | Bacteria | 66130 |
| 38 | IMNBL1DRAFT_c0000056 | 3300000062 | Bacteria | 106919 |
| 39 | IMNBL1DRAFT_c0021664 | 3300000062 | Bacteria | 2565 |
| 40 | IMNBL1DRAFT_c0052760 | 3300000062 | Bacteria | 1272 |
| 41 | JGI24702J35022_10269611 | 3300002462 | Bacteria | 996 |
| 42 | Ga0068305_10851235 | 3300005083 | Bacteria | 2630 |
| 43 | Ga0104045_1008575 | 3300007085 | Bacteria | 2211 |
| 44 | Ga0102734_1000175 | 3300007129 | Bacteria | 20528 |
| 45 | Ga0104019_1196940 | 3300007150 | Bacteria | 1112 |
| 46 | Ga0103267_1023028 | 3300007190 | Bacteria | 2061 |
| 47 | Ga0123357_10062418 | 3300009784 | Bacteria | 4989 |
| 48 | Ga0123353_10004979 | 3300010167 | Bacteria | 17306 |
| 49 | Ga0123353_11307660 | 3300010167 | Bacteria | 941 |
| 50 | Ga0123354_10045541 | 3300010882 | Bacteria | 6713 |
| 51 | Ga0123354_10122526 | 3300010882 | Bacteria | 3346 |
| 52 | Ga0123354_10146620 | 3300010882 | Bacteria | 2885 |
| 53 | Ga0466701_071564 | 3300042598 | Bacteria | 4629 |
| 54 | Ga0466701_101758 | 3300042598 | Bacteria | 95224 |
| 55 | Ga0466706_085050 | 3300042599 | Bacteria | 34505 |
| 56 | Ga0466706_089391 | 3300042599 | Bacteria | 6268 |
| 57 | Ga0466706_160827 | 3300042599 | Bacteria | 31004 |
| 58 | Ga0466714_030409 | 3300042603 | Bacteria | 3435 |
| 59 | Ga0466714_035266 | 3300042603 | Bacteria | 2406 |
| 60 | Ga0466714_126469 | 3300042603 | Bacteria | 66148 |
| 61 | Ga0466716_214791 | 3300042605 | Bacteria | 2978 |
| 62 | Ga0466716_449927 | 3300042605 | Bacteria | 4158 |
| 63 | Ga0466721_073227 | 3300042608 | Bacteria | 2303 |
| 64 | Ga0466722_123554 | 3300042609 | Bacteria | 11164 |
| 65 | Ga0466712_124664 | 3300042614 | Bacteria | 2034 |
| 66 | Ga0466711_155701 | 3300042615 | Bacteria | 12048 |
| 67 | Ga0466711_210957 | 3300042615 | Bacteria | 3626 |
| 68 | Ga0466711_308491 | 3300042615 | Bacteria | 3441 |
| 69 | Ga0466718_093822 | 3300042617 | Bacteria | 1097 |
| 70 | Ga0466723_092677 | 3300042618 | Bacteria | 22716 |
| 71 | Ga0466726_056744 | 3300042619 | Bacteria | 6981 |
| 72 | Ga0466726_141993 | 3300042619 | Bacteria | 7655 |
| 73 | Ga0466690_171518 | 3300042590 | Bacteria | 4140 |
| 74 | Ga0466691_164143 | 3300042593 | Bacteria | 2309 |
| 75 | Ga0466694_012704 | 3300042594 | Unclassified | 2311 |
| 76 | Ga0466696_010079 | 3300042596 | Bacteria | 13527 |
| 77 | Ga0466696_254260 | 3300042596 | Bacteria | 24185 |
| 78 | Ga0466729_215074 | 3300042621 | Bacteria | 2329 |
| 79 | Ga0466735_107458 | 3300042624 | Bacteria | 3137 |
| 80 | Ga0466703_122128 | 3300042636 | Bacteria | 7487 |
| 81 | Ga0466703_131731 | 3300042636 | Bacteria | 7138 |
| 82 | Ga0466703_352187 | 3300042636 | Bacteria | 1404 |
| 83 | Ga0466704_269820 | 3300042643 | Bacteria | 13523 |
| 84 | Ga0466708_170849 | 3300042652 | Bacteria | 4371 |
| 85 | Ga0466708_405823 | 3300042652 | Bacteria | 2161 |
| 86 | IMNBL1DRAFT_c0035606 | 3300000062 | Bacteria | 1752 |
| 87 | IMNBL1DRAFT_c0097826 | 3300000062 | Bacteria | 794 |
| 88 | JGI24699J35502_11133850 | 3300002509 | Bacteria | 17080 |
| 89 | JGI24699J35502_11133885 | 3300002509 | Bacteria | 18160 |
| 90 | JGI24699J35502_11134211 | 3300002509 | Bacteria | 60442 |
| 91 | JGI24696J40584_12949749 | 3300002834 | Bacteria | 2097 |
| 92 | CVPL010W_10000609 | 3300002931 | Bacteria | 39279 |
| 93 | Ga0068305_10749342 | 3300005083 | Bacteria | 3167 |
| 94 | Ga0072941_1100666 | 3300005201 | Bacteria | 3047 |
| 95 | Ga0102739_1000086 | 3300007095 | Bacteria | 25596 |
| 96 | Ga0105005_1014017 | 3300007505 | Bacteria | 9419 |
| 97 | Ga0123356_10059865 | 3300010049 | Bacteria | 3553 |
| 98 | Ga0466707_053900 | 3300042601 | Bacteria | 1496 |
| 99 | Ga0466707_112594 | 3300042601 | Bacteria | 1387 |
| 100 | Ga0466707_180781 | 3300042601 | Bacteria | 11649 |
| 101 | Ga0466714_009109 | 3300042603 | Bacteria | 7353 |
| 102 | Ga0466714_021809 | 3300042603 | Bacteria | 2126 |
| 103 | Ga0466714_037214 | 3300042603 | Bacteria | 1367 |
| 104 | Ga0466714_061940 | 3300042603 | Bacteria | 1746 |
| 105 | Ga0466716_484962 | 3300042605 | Bacteria | 1803 |
| 106 | Ga0466719_517237 | 3300042606 | Bacteria | 14063 |
| 107 | Ga0466710_108507 | 3300042613 | Bacteria | 1503 |
| 108 | Ga0466710_443636 | 3300042613 | Bacteria | 4223 |
| 109 | Ga0466715_346793 | 3300042616 | Bacteria | 22249 |
| 110 | Ga0466728_420477 | 3300042620 | Bacteria | 25205 |
| 111 | Ga0466729_176883 | 3300042621 | Bacteria | 2062 |
| 112 | Ga0160469_102018 | 3300012824 | Bacteria | 4339 |
| 113 | Ga0466690_021291 | 3300042590 | Bacteria | 1465 |
| 114 | Ga0466690_059292 | 3300042590 | Bacteria | 6987 |
| 115 | Ga0466690_339386 | 3300042590 | Bacteria | 6419 |
| 116 | Ga0466691_076199 | 3300042593 | Bacteria | 5074 |
| 117 | Ga0466696_108775 | 3300042596 | Bacteria | 27757 |
| 118 | Ga0466696_257240 | 3300042596 | Bacteria | 7789 |
| 119 | Ga0466699_378655 | 3300042597 | Bacteria | 2402 |
| 120 | Ga0466705_033650 | 3300042612 | Bacteria | 6830 |
| 121 | Ga0466705_084401 | 3300042612 | Bacteria | 19488 |
| 122 | Ga0466703_046406 | 3300042636 | Bacteria | 4720 |
| 123 | Ga0466703_280503 | 3300042636 | Bacteria | 24175 |
| 124 | Ga0466704_102348 | 3300042643 | Bacteria | 9428 |
| 125 | Ga0466704_244636 | 3300042643 | Bacteria | 19020 |
| 126 | Ga0466727_339815 | 3300042655 | Bacteria | 1519 |
| 127 | Ga0072940_1075433 | 3300005200 | Bacteria | 1400 |
| 128 | Ga0072941_1281331 | 3300005201 | Bacteria | 1695 |
| 129 | Ga0103265_1000203 | 3300007068 | Bacteria | 10195 |
| 130 | Ga0102737_1000105 | 3300007142 | Unclassified | 26195 |
| 131 | Ga0104050_1000547 | 3300007153 | Bacteria | 2576 |
| 132 | Ga0123356_10561778 | 3300010049 | Bacteria | 1303 |
| 133 | Ga0123353_10163207 | 3300010167 | Bacteria | 3545 |
| 134 | Ga0123354_10017809 | 3300010882 | Bacteria | 11129 |
| 135 | Ga0466732_369489 | 3300042656 | Bacteria | 1916 |
| 136 | Ga0466701_080572 | 3300042598 | Bacteria | 2148 |
| 137 | Ga0466706_065473 | 3300042599 | Bacteria | 19318 |
| 138 | Ga0466706_147365 | 3300042599 | Bacteria | 6178 |
| 139 | Ga0466707_148566 | 3300042601 | Bacteria | 35043 |
| 140 | Ga0466713_152770 | 3300042602 | Unclassified | 1238 |
| 141 | Ga0466714_012858 | 3300042603 | Bacteria | 3360 |
| 142 | Ga0466714_013796 | 3300042603 | Bacteria | 3571 |
| 143 | Ga0466722_164674 | 3300042609 | Bacteria | 8708 |
| 144 | Ga0466705_510664 | 3300042612 | Bacteria | 7836 |
| 145 | Ga0466711_071713 | 3300042615 | Bacteria | 4080 |
| 146 | Ga0466715_223437 | 3300042616 | Bacteria | 30992 |
| 147 | Ga0466728_284109 | 3300042620 | Bacteria | 4870 |
| 148 | Ga0466728_347669 | 3300042620 | Bacteria | 1232 |
| 149 | Ga0466690_235471 | 3300042590 | Bacteria | 5779 |
| 150 | Ga0466691_179806 | 3300042593 | Bacteria | 1512 |
| 151 | Ga0466697_137236 | 3300042611 | Bacteria | 1464 |
| 152 | Ga0466705_035441 | 3300042612 | Bacteria | 6678 |
| 153 | Ga0466705_123350 | 3300042612 | Bacteria | 4905 |
| 154 | Ga0466731_337031 | 3300042622 | Bacteria | 1187 |
| 155 | Ga0466702_108766 | 3300042635 | Bacteria | 1258 |
| 156 | Ga0466703_218033 | 3300042636 | Bacteria | 11419 |
| 157 | Ga0466703_232938 | 3300042636 | Bacteria | 8340 |
| 158 | Ga0466724_21956 | 3300042649 | Bacteria | 426457 |
| 159 | Ga0466708_095033 | 3300042652 | Bacteria | 42990 |
| 160 | Ga0466708_152954 | 3300042652 | Bacteria | 7432 |
| 161 | Ga0466727_333421 | 3300042655 | Bacteria | 6624 |
| 162 | 2227572434 | 2225789004 | Unclassified | 2599 |
| 163 | IMNBL1DRAFT_c0000270 | 3300000062 | Bacteria | 45954 |
| 164 | IMNBL1DRAFT_c0007048 | 3300000062 | Bacteria | 5991 |
| 165 | IMNBL1DRAFT_c0018331 | 3300000062 | Bacteria | 2914 |
| 166 | IMNBL1DRAFT_c0019372 | 3300000062 | Bacteria | 2791 |
| 167 | JGI24702J35022_10026581 | 3300002462 | Unclassified | 3117 |
| 168 | Ga0074308_1113623 | 3300005307 | Unclassified | 3100 |
| 169 | Ga0104048_1000353 | 3300007143 | Bacteria | 6229 |
| 170 | Ga0123353_10000019 | 3300010167 | Bacteria | 185006 |
| 171 | Ga0123353_10007698 | 3300010167 | Bacteria | 14609 |
| 172 | Ga0123353_11552061 | 3300010167 | Bacteria | 840 |
| 173 | Ga0123353_11663731 | 3300010167 | Bacteria | 802 |
| 174 | Ga0123354_10085643 | 3300010882 | Bacteria | 4413 |
| 175 | Ga0466733_121761 | 3300042659 | Bacteria | 8528 |
| 176 | Ga0466733_219698 | 3300042659 | Bacteria | 12162 |
| 177 | Ga0466706_171356 | 3300042599 | Bacteria | 1817 |
| 178 | Ga0466706_178052 | 3300042599 | Bacteria | 1852 |
| 179 | Ga0466706_209610 | 3300042599 | Bacteria | 69562 |
| 180 | Ga0466707_083114 | 3300042601 | Bacteria | 16238 |
| 181 | Ga0466713_122827 | 3300042602 | Bacteria | 174567 |
| 182 | Ga0466713_149763 | 3300042602 | Bacteria | 1851 |
| 183 | Ga0466714_019482 | 3300042603 | Bacteria | 68715 |
| 184 | Ga0466714_023572 | 3300042603 | Bacteria | 1522 |
| 185 | Ga0466714_072816 | 3300042603 | Bacteria | 12417 |
| 186 | Ga0466716_102169 | 3300042605 | Bacteria | 3124 |
| 187 | Ga0466719_149177 | 3300042606 | Bacteria | 5068 |
| 188 | Ga0466721_269998 | 3300042608 | Bacteria | 1553 |
| 189 | Ga0466722_176901 | 3300042609 | Bacteria | 2334 |
| 190 | Ga0466697_000635 | 3300042611 | Bacteria | 14006 |
| 191 | Ga0466711_117298 | 3300042615 | Bacteria | 1467 |
| 192 | Ga0466711_122031 | 3300042615 | Bacteria | 2175 |
| 193 | Ga0466711_145131 | 3300042615 | Bacteria | 39663 |
| 194 | Ga0466711_239934 | 3300042615 | Bacteria | 17196 |
| 195 | Ga0466715_033953 | 3300042616 | Bacteria | 34236 |
| 196 | Ga0466715_090334 | 3300042616 | Bacteria | 8566 |
| 197 | Ga0466715_615123 | 3300042616 | Bacteria | 1067 |
| 198 | Ga0466723_039913 | 3300042618 | Bacteria | 8162 |
| 199 | Ga0466723_079245 | 3300042618 | Bacteria | 12025 |
| 200 | Ga0466726_115726 | 3300042619 | Bacteria | 4824 |
| 201 | Ga0466728_122844 | 3300042620 | Bacteria | 12635 |
| 202 | Ga0466729_149369 | 3300042621 | Bacteria | 2443 |
| 203 | Ga0160457_1006047 | 3300012858 | Bacteria | 1810 |
| 204 | Ga0466692_160536 | 3300042591 | Bacteria | 1629 |
| 205 | Ga0466696_146362 | 3300042596 | Bacteria | 19783 |
| 206 | Ga0466696_259711 | 3300042596 | Bacteria | 25289 |
| 207 | Ga0466705_175096 | 3300042612 | Bacteria | 32654 |
| 208 | Ga0466730_081936 | 3300042625 | Bacteria | 13722 |
| 209 | Ga0466703_040466 | 3300042636 | Bacteria | 5498 |
| 210 | Ga0466703_162055 | 3300042636 | Bacteria | 3688 |
| 211 | Ga0466703_336984 | 3300042636 | Bacteria | 4790 |
| 212 | Ga0466703_385403 | 3300042636 | Bacteria | 1712 |
| 213 | Ga0466704_120956 | 3300042643 | Bacteria | 12850 |
| 214 | Ga0466708_050428 | 3300042652 | Bacteria | 5173 |
| 215 | 2227504085 | 2225789004 | Unclassified | 3724 |
| 216 | 2227662667 | 2225789004 | Bacteria | 1940 |
| 217 | IMNBL1DRAFT_c0000216 | 3300000062 | Bacteria | 50594 |
| 218 | IMNBL1DRAFT_c0017398 | 3300000062 | Bacteria | 3026 |
| 219 | JGI24705J35276_12200672 | 3300002504 | Bacteria | 1606 |
| 220 | Ga0072941_1082653 | 3300005201 | Bacteria | 7704 |
| 221 | Ga0104045_1002382 | 3300007085 | Bacteria | 5323 |
| 222 | Ga0103267_1000966 | 3300007190 | Bacteria | 7222 |
| 223 | Ga0103268_1000215 | 3300007192 | Bacteria | 19226 |
| 224 | Ga0123357_10000306 | 3300009784 | Bacteria | 46839 |
| 225 | Ga0123355_10474232 | 3300009826 | Bacteria | 1561 |
| 226 | Ga0123353_10151234 | 3300010167 | Bacteria | 3706 |
| 227 | Ga0123353_10174601 | 3300010167 | Bacteria | 3408 |
| 228 | Ga0123353_11492581 | 3300010167 | Bacteria | 862 |
| 229 | Ga0123354_10033083 | 3300010882 | Bacteria | 8096 |
| 230 | Ga0466733_066683 | 3300042659 | Bacteria | 2488 |
| 231 | Ga0466701_046108 | 3300042598 | Bacteria | 2403 |
| 232 | Ga0466706_076331 | 3300042599 | Bacteria | 34187 |
| 233 | Ga0466714_090093 | 3300042603 | Bacteria | 1167 |
| 234 | Ga0466715_001888 | 3300042616 | Bacteria | 2020 |
| 235 | Ga0466715_161468 | 3300042616 | Bacteria | 1061 |
| 236 | Ga0466729_194578 | 3300042621 | Bacteria | 12153 |
| 237 | Ga0466692_110056 | 3300042591 | Bacteria | 56697 |
| 238 | Ga0466692_122966 | 3300042591 | Bacteria | 22698 |
| 239 | Ga0466691_216784 | 3300042593 | Bacteria | 3334 |
| 240 | Ga0466696_081230 | 3300042596 | Bacteria | 3724 |
| 241 | Ga0466696_218381 | 3300042596 | Bacteria | 1926 |
| 242 | Ga0466696_366704 | 3300042596 | Bacteria | 7882 |
| 243 | Ga0466696_467012 | 3300042596 | Bacteria | 2282 |
| 244 | Ga0466735_091998 | 3300042624 | Bacteria | 2126 |
| 245 | Ga0466704_015140 | 3300042643 | Bacteria | 23812 |
| 246 | Ga0466709_121677 | 3300042648 | Unclassified | 2233 |
| 247 | Ga0466709_252452 | 3300042648 | Bacteria | 8786 |
| 248 | Ga0466708_168769 | 3300042652 | Bacteria | 4264 |
| 249 | 2227275225 | 2225789004 | Bacteria | 30519 |
| 250 | 2227303002 | 2225789004 | Bacteria | 29616 |
| 251 | IMNBL1DRAFT_c0000785 | 3300000062 | Bacteria | 25114 |
| 252 | IMNBL1DRAFT_c0001109 | 3300000062 | Bacteria | 20634 |
| 253 | IMNBL1DRAFT_c0037684 | 3300000062 | Bacteria | 1672 |
| 254 | JGI24702J35022_10005614 | 3300002462 | Unclassified | 7317 |
| 255 | Ga0068305_10036533 | 3300005083 | Bacteria | 46563 |
| 256 | Ga0102735_1000235 | 3300007080 | Bacteria | 19488 |
| 257 | Ga0104050_1003883 | 3300007153 | Bacteria | 3489 |
| 258 | Ga0123357_10639626 | 3300009784 | Bacteria | 794 |
| 259 | Ga0123353_10019714 | 3300010167 | Bacteria | 10036 |
| 260 | Ga0123353_10740838 | 3300010167 | Bacteria | 1370 |
| 261 | Ga0123353_10756515 | 3300010167 | Bacteria | 1351 |
| 262 | Ga0123354_10137783 | 3300010882 | Bacteria | 3040 |
| 263 | Ga0123354_10191136 | 3300010882 | Bacteria | 2291 |
| 264 | Ga0466732_440629 | 3300042656 | Bacteria | 1160 |
| 265 | Ga0466706_120960 | 3300042599 | Bacteria | 15301 |
| 266 | Ga0466700_119367 | 3300042600 | Bacteria | 51339 |
| 267 | Ga0466700_143177 | 3300042600 | Bacteria | 14060 |
| 268 | Ga0466700_264674 | 3300042600 | Bacteria | 1634 |
| 269 | Ga0466713_026892 | 3300042602 | Bacteria | 11456 |
| 270 | Ga0466713_059440 | 3300042602 | Bacteria | 68698 |
| 271 | Ga0466714_028328 | 3300042603 | Bacteria | 1323 |
| 272 | Ga0466714_136077 | 3300042603 | Bacteria | 139396 |
| 273 | Ga0466717_210722 | 3300042604 | Unclassified | 3597 |
| 274 | Ga0466716_107962 | 3300042605 | Bacteria | 2751 |
| 275 | Ga0466719_243643 | 3300042606 | Bacteria | 21193 |
| 276 | Ga0466719_311544 | 3300042606 | Bacteria | 4073 |
| 277 | Ga0466722_088000 | 3300042609 | Bacteria | 12671 |
| 278 | Ga0466711_088394 | 3300042615 | Bacteria | 6324 |
| 279 | Ga0466711_128935 | 3300042615 | Bacteria | 5191 |
| 280 | Ga0466711_173885 | 3300042615 | Bacteria | 5019 |
| 281 | Ga0466723_220384 | 3300042618 | Bacteria | 2810 |
| 282 | Ga0466723_271308 | 3300042618 | Bacteria | 19297 |
| 283 | Ga0160433_108634 | 3300012846 | Bacteria | 1361 |
| 284 | Ga0466690_089085 | 3300042590 | Bacteria | 7131 |
| 285 | Ga0466690_125536 | 3300042590 | Bacteria | 1457 |
| 286 | Ga0466692_006453 | 3300042591 | Bacteria | 14043 |
| 287 | Ga0466692_099787 | 3300042591 | Bacteria | 3510 |
| 288 | Ga0466694_010907 | 3300042594 | Bacteria | 2297 |
| 289 | Ga0466705_130292 | 3300042612 | Bacteria | 9509 |
| 290 | Ga0466705_357512 | 3300042612 | Bacteria | 2076 |
| 291 | Ga0466704_412311 | 3300042643 | Bacteria | 7105 |
| 292 | Ga0466708_400273 | 3300042652 | Bacteria | 55189 |
| 293 | Ga0466727_306287 | 3300042655 | Bacteria | 8716 |
| 294 | Ga0466727_342338 | 3300042655 | Unclassified | 2370 |
| 295 | JGI24699J35502_11032248 | 3300002509 | Bacteria | 1518 |
| 296 | Ga0068302_10473375 | 3300005071 | Bacteria | 2412 |
| 297 | Ga0072941_1069700 | 3300005201 | Bacteria | 1432 |
| 298 | Ga0104048_1001397 | 3300007143 | Bacteria | 3070 |
| 299 | Ga0123357_10518762 | 3300009784 | Bacteria | 975 |
| 300 | Ga0123353_10001135 | 3300010167 | Bacteria | 32414 |
| 301 | Ga0123353_10010485 | 3300010167 | Bacteria | 12920 |
| 302 | Ga0123353_10565167 | 3300010167 | Bacteria | 1636 |
| 303 | Ga0466732_082485 | 3300042656 | Bacteria | 3369 |
| 304 | Ga0466733_165942 | 3300042659 | Bacteria | 49543 |
| 305 | Ga0466733_210826 | 3300042659 | Bacteria | 17624 |
| 306 | Ga0466701_021293 | 3300042598 | Bacteria | 1025 |
| 307 | Ga0466706_004062 | 3300042599 | Bacteria | 54084 |
| 308 | Ga0466707_314308 | 3300042601 | Bacteria | 31979 |
| 309 | Ga0466707_322321 | 3300042601 | Bacteria | 10124 |
| 310 | Ga0466713_072003 | 3300042602 | Bacteria | 72866 |
| 311 | Ga0466716_441168 | 3300042605 | Bacteria | 7504 |
| 312 | Ga0466711_079239 | 3300042615 | Bacteria | 1680 |
| 313 | Ga0466711_330587 | 3300042615 | Bacteria | 18688 |
| 314 | Ga0466715_146421 | 3300042616 | Bacteria | 7253 |
| 315 | Ga0466715_329130 | 3300042616 | Bacteria | 55839 |
| 316 | Ga0466728_182332 | 3300042620 | Bacteria | 20539 |
| 317 | Ga0264413_156640 | 3300024493 | Bacteria | 2315 |
| 318 | Ga0466690_332773 | 3300042590 | Bacteria | 19205 |
| 319 | Ga0466692_146653 | 3300042591 | Bacteria | 22871 |
| 320 | Ga0466705_007182 | 3300042612 | Bacteria | 4015 |
| 321 | Ga0466703_058087 | 3300042636 | Bacteria | 19917 |
| 322 | Ga0466703_129766 | 3300042636 | Bacteria | 1993 |
| 323 | Ga0466703_272532 | 3300042636 | Bacteria | 2223 |
| 324 | Ga0466704_010086 | 3300042643 | Bacteria | 24092 |
| 325 | Ga0466704_011881 | 3300042643 | Bacteria | 7344 |
| 326 | Ga0466704_207225 | 3300042643 | Bacteria | 4244 |
| 327 | Ga0466709_226395 | 3300042648 | Bacteria | 1781 |
| 328 | Ga0466709_227908 | 3300042648 | Bacteria | 46017 |
| 329 | Ga0466724_13241 | 3300042649 | Bacteria | 17212 |
| 330 | Ga0466724_53539 | 3300042649 | Bacteria | 21378 |
| 331 | Ga0466727_301265 | 3300042655 | Bacteria | 1583 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF02545 | Maf | Maf-like protein | 11 | 194 | 0.92 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF02545 | GO:0047429 | nucleoside triphosphate diphosphatase activity | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.