Protein Family IF06085

Metagenome Isolate
296 Members
88 Samples
261 Scaffolds
370.04 Avg Length

🧬 Representative Sequence

ID
3300042602|Ga0466713_064405|Ga0466713_064405_108205_109425
Length
406 aa
Sequence
MLPKDTKCKNPFINKYLNHMRSIKLFITVCFALISVCAYTQNYNGLDSNMGNLYMLSNAKTRSISPENFTGEKGKGGMAVPTGERGERNVSNATWAARDLGQGWKVNPFITINSGETFTLAEIEGPGAIQHIWMTPTGNWRFSILRIYWDDEKEPSVECPVGDFFGMGWGVYAPLSSLAVCVNPGSAFNCYWTMPFRKKCRITMENINDAAPMNLYYQIDYALTEVPNDAAYFHAQFRRTNPNATSDYTIIDGIRGKGHYVGIYLAQGVNNNGWWGEGEIKFFMDGDTKFPTICGTGAEDYFCGSYNFDREGQYKEFCTAYAGLHQVIRPDGTYRSQQRFGMYRWHITDPVRFEKDLRITIQDLGWRHGGRYLPQKSDMSSVAFWYQAEPHNKFPKLPVWQELEVN

πŸ“Š Sample Types

Isolate 11.8%
Metagenome 88.2%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Unclassified 28.4%
Termitidae 27.3%
Kalotermitidae 14.8%
Blattidae 13.6%
Rhinotermitidae 4.5%
Termopsidae 4.5%
Passalidae 3.4%
Armadillidiidae 2.3%
Hodotermitidae 1.1%

🌳 Taxonomy

Archaea 0
Bacteria 279
Eukaryota 0
Viruses 0
Unclassified 17

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820551407 Unclassified Firmicutes Emb289P4bin38 Isolate Unclassified
2 2820623020 Unclassified Firmicutes Emb289P1bin126 Isolate Unclassified
3 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
4 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
5 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
6 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
7 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
8 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
9 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
10 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
11 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
12 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
13 2781125693 Treponema sp. Th196P3bin148 Isolate Unclassified
14 2820252425 Unclassified Firmicutes Th196P3bin6 Isolate Unclassified
15 2820429680 Unclassified Firmicutes Lab288P3bin30 Isolate Unclassified
16 2820455747 Unclassified Firmicutes Lab288P3bin160 Isolate Unclassified
17 2820541116 Unclassified Firmicutes Lab288P1bin109 Isolate Unclassified
18 2820644600 Unclassified Firmicutes Cu122P5bin39 Isolate Unclassified
19 2820654856 Unclassified Firmicutes Cu122P1bin2 Isolate Unclassified
20 2940313741 Parabacteroides sp. PH5-17 Isolate Blattidae
21 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
22 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
23 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
24 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
25 2820336130 Unclassified Firmicutes Nt197P3bin70 Isolate Unclassified
26 2940212447 Parabacteroides sp. PH5-16 Isolate Blattidae
27 2940302308 Parabacteroides sp. PF5-5 Isolate Blattidae
28 2940321370 Parabacteroides sp. PH5-39 Isolate Blattidae
29 2940332795 Parabacteroides sp. PH5-8 Isolate Blattidae
30 8100166142 Dysgonomonas sp. GY75 Isolate Rhinotermitidae
31 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
32 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
33 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
34 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
35 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
36 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
37 3300012841 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E1 MG Metagenome Armadillidiidae
38 3300012847 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG Metagenome Armadillidiidae
39 2820414148 Unclassified Firmicutes Lab288P3bin93 Isolate Unclassified
40 2820432912 Unclassified Firmicutes Lab288P3bin219 Isolate Unclassified
41 2820530790 Unclassified Firmicutes Lab288P1bin141 Isolate Unclassified
42 2820657860 Unclassified Firmicutes Co191P4bin15 Isolate Unclassified
43 2820663833 Unclassified Firmicutes Co191P3bin41 Isolate Unclassified
44 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
45 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
46 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
47 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
48 2781125666 Treponema sp. Emb289P4bin7 Isolate Unclassified
49 2820405014 Unclassified Firmicutes Lab288P4bin88 Isolate Unclassified
50 2820435670 Unclassified Firmicutes Lab288P3bin217 Isolate Unclassified
51 2820698910 Unclassified Firmicutes Co191P1bin64 Isolate Unclassified
52 2940306115 Parabacteroides sp. PFB2-22 Isolate Blattidae
53 2940309933 Parabacteroides sp. PH5-13 Isolate Blattidae
54 2940328985 Parabacteroides sp. PH5-46 Isolate Blattidae
55 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
56 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
57 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
58 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
59 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
60 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
61 3300000036 Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) Metagenome Passalidae
62 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
63 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
64 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
65 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
66 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
67 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
68 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
69 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
70 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
71 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
72 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
73 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
74 2820362221 Unclassified Firmicutes Nt197P3bin116 Isolate Unclassified
75 2940205530 Parabacteroides sp. PH5-33 Isolate Blattidae
76 2940317558 Parabacteroides sp. PH5-26 Isolate Blattidae
77 2940325180 Parabacteroides sp. PH5-41 Isolate Blattidae
78 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
79 2820408893 Unclassified Firmicutes Lab288P4bin80 Isolate Unclassified
80 2820200053 Unclassified Planctomycetes Cu122P5bin40 Isolate Unclassified
81 2940298504 Parabacteroides sp. PF5-13 Isolate Blattidae
82 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
83 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
84 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
85 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
86 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
87 3300002501 Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 Metagenome Termitidae
88 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0123357_10106772 3300009784 Bacteria 3588
2 Ga0123355_10008190 3300009826 Bacteria 15789
3 Ga0123353_10108085 3300010167 Bacteria 4483
4 Ga0123353_10396715 3300010167 Unclassified 2055
5 IMNBL1DRAFT_c0005448 3300000062 Bacteria 7273
6 IMNBL1DRAFT_c0008603 3300000062 Bacteria 5174
7 JGI24702J35022_10009704 3300002462 Bacteria 5399
8 JGI24705J35276_12222691 3300002504 Bacteria 2443
9 Ga0068305_10315735 3300005083 Unclassified 1534
10 Ga0466707_099680 3300042601 Bacteria 1850
11 Ga0466719_358030 3300042606 Bacteria 1944
12 Ga0466722_043134 3300042609 Bacteria 89421
13 Ga0466735_232024 3300042624 Bacteria 2646
14 Ga0466704_065232 3300042643 Bacteria 37254
15 Ga0466704_290667 3300042643 Bacteria 3798
16 Ga0466709_000209 3300042648 Bacteria 15203
17 Ga0466708_238584 3300042652 Bacteria 14219
18 Ga0466727_300187 3300042655 Bacteria 11290
19 Ga0466715_232894 3300042616 Bacteria 30718
20 Ga0466723_061160 3300042618 Bacteria 19334
21 Ga0466729_100998 3300042621 Bacteria 1843
22 Ga0123355_10181401 3300009826 Bacteria 3124
23 Ga0123356_10089743 3300010049 Bacteria 2925
24 Ga0123356_10114219 3300010049 Bacteria 2614
25 Ga0123356_10119020 3300010049 Bacteria 2565
26 Ga0123353_10027860 3300010167 Bacteria 8666
27 Ga0123353_10044208 3300010167 Bacteria 7060
28 Ga0123353_10151945 3300010167 Bacteria 3695
29 Ga0123353_10739210 3300010167 Unclassified 1372
30 Ga0123354_10108432 3300010882 Unclassified 3688
31 2227584359 2225789004 Bacteria 2479
32 IMNBL1DRAFT_c0008749 3300000062 Bacteria 5110
33 JGI24702J35022_10017795 3300002462 Bacteria 3880
34 JGI24702J35022_10064772 3300002462 Bacteria 1960
35 JGI24696J40584_12960771 3300002834 Bacteria 8456
36 Ga0068305_10005871 3300005083 Bacteria 24046
37 Ga0466700_276236 3300042600 Bacteria 3462
38 Ga0466713_005174 3300042602 Bacteria 19592
39 Ga0466713_152985 3300042602 Bacteria 166324
40 Ga0466716_170551 3300042605 Bacteria 7788
41 Ga0466716_190814 3300042605 Bacteria 3421
42 Ga0466716_246572 3300042605 Bacteria 16133
43 Ga0466719_108955 3300042606 Bacteria 41298
44 Ga0466722_045953 3300042609 Bacteria 33741
45 Ga0415639_129929 3300038395 Bacteria 3235
46 Ga0466690_032396 3300042590 Bacteria 7575
47 Ga0466690_118790 3300042590 Bacteria 7075
48 Ga0466690_156481 3300042590 Bacteria 32612
49 Ga0466705_081179 3300042612 Bacteria 19501
50 Ga0466731_369067 3300042622 Bacteria 2265
51 Ga0466704_048073 3300042643 Bacteria 3566
52 Ga0466704_152823 3300042643 Bacteria 2222
53 Ga0466725_103941 3300042654 Bacteria 14079
54 Ga0466733_197521 3300042659 Bacteria 10437
55 Ga0466715_088356 3300042616 Unclassified 9585
56 Ga0466715_299417 3300042616 Bacteria 33411
57 Ga0466726_239991 3300042619 Bacteria 5044
58 Ga0123357_10016396 3300009784 Bacteria 9749
59 Ga0123357_10024685 3300009784 Bacteria 8098
60 Ga0123357_10247633 3300009784 Bacteria 1915
61 Ga0123355_10046127 3300009826 Bacteria 7089
62 Ga0123355_10239486 3300009826 Bacteria 2574
63 Ga0123355_10264761 3300009826 Bacteria 2399
64 Ga0123356_10008036 3300010049 Bacteria 10500
65 Ga0123356_10026837 3300010049 Bacteria 5402
66 Ga0123356_10058503 3300010049 Bacteria 3594
67 Ga0123353_10000196 3300010167 Bacteria 76783
68 Ga0123353_10006183 3300010167 Bacteria 15899
69 Ga0123353_10075817 3300010167 Bacteria 5404
70 Ga0123353_10127773 3300010167 Bacteria 4082
71 Ga0123353_10234490 3300010167 Bacteria 2858
72 Ga0123353_10658194 3300010167 Bacteria 1481
73 JGI24702J35022_10007786 3300002462 Bacteria 6113
74 JGI24702J35022_10049717 3300002462 Unclassified 2233
75 Ga0466713_064405 3300042602 Bacteria 152501
76 Ga0466716_245165 3300042605 Bacteria 4293
77 Ga0466722_267876 3300042609 Bacteria 7084
78 Ga0160445_101719 3300012847 Bacteria 5771
79 Ga0415639_187417 3300038395 Bacteria 1714
80 Ga0466696_303881 3300042596 Bacteria 27627
81 Ga0466705_087547 3300042612 Unclassified 8457
82 Ga0466703_165890 3300042636 Bacteria 18285
83 Ga0466703_261281 3300042636 Bacteria 5527
84 Ga0466709_357970 3300042648 Bacteria 46997
85 Ga0466715_292557 3300042616 Bacteria 20428
86 Ga0466715_456493 3300042616 Bacteria 86871
87 Ga0466726_397183 3300042619 Bacteria 3362
88 Ga0466728_100856 3300042620 Bacteria 9839
89 Ga0123357_10011684 3300009784 Bacteria 11281
90 Ga0123357_10120364 3300009784 Bacteria 3309
91 Ga0123355_10009869 3300009826 Bacteria 14567
92 Ga0123355_10010916 3300009826 Bacteria 13977
93 Ga0123355_10028001 3300009826 Unclassified 9109
94 Ga0123355_10050266 3300009826 Bacteria 6774
95 Ga0123356_10463359 3300010049 Bacteria 1417
96 Ga0123353_10001551 3300010167 Bacteria 28152
97 Ga0123353_10002521 3300010167 Bacteria 22757
98 Ga0123353_10004846 3300010167 Bacteria 17484
99 IMNBL1DRAFT_c0004188 3300000062 Bacteria 8767
100 JGI24702J35022_10069307 3300002462 Unclassified 1897
101 JGI24703J35330_11589984 3300002501 Bacteria 1338
102 Ga0466707_093107 3300042601 Bacteria 31059
103 Ga0466707_248509 3300042601 Bacteria 2878
104 Ga0466713_087343 3300042602 Bacteria 44025
105 Ga0466719_136473 3300042606 Bacteria 6100
106 Ga0466719_237269 3300042606 Bacteria 1886
107 Ga0415639_043930 3300038395 Bacteria 12752
108 Ga0466694_151302 3300042594 Bacteria 2291
109 Ga0466696_006364 3300042596 Bacteria 2215
110 Ga0466734_171936 3300042623 Bacteria 1543
111 Ga0466702_405196 3300042635 Bacteria 7505
112 Ga0466703_291472 3300042636 Bacteria 7017
113 Ga0466703_418305 3300042636 Bacteria 1622
114 Ga0466704_109926 3300042643 Bacteria 2843
115 Ga0466704_523262 3300042643 Bacteria 10084
116 Ga0466727_030679 3300042655 Bacteria 2029
117 Ga0466727_232063 3300042655 Bacteria 2121
118 Ga0466727_312031 3300042655 Bacteria 4378
119 Ga0466715_036057 3300042616 Bacteria 24300
120 Ga0466726_368877 3300042619 Bacteria 2339
121 Ga0466726_485382 3300042619 Bacteria 1787
122 Ga0466728_032026 3300042620 Bacteria 3061
123 Ga0466728_122619 3300042620 Bacteria 4569
124 Ga0123357_10082424 3300009784 Bacteria 4223
125 Ga0123357_10222232 3300009784 Bacteria 2092
126 Ga0123353_10000174 3300010167 Bacteria 81672
127 Ga0123353_10027145 3300010167 Bacteria 8769
128 Ga0123353_10032285 3300010167 Unclassified 8128
129 Ga0123353_10097348 3300010167 Bacteria 4742
130 Ga0123353_10108382 3300010167 Bacteria 4476
131 Ga0123354_10023449 3300010882 Bacteria 9733
132 IMNBL1DRAFT_c0005521 3300000062 Bacteria 7206
133 JGI24705J35276_12236667 3300002504 Bacteria 8571
134 Ga0466707_145041 3300042601 Bacteria 1335
135 Ga0466713_010003 3300042602 Bacteria 49152
136 Ga0466716_352883 3300042605 Bacteria 6656
137 Ga0466719_040603 3300042606 Unclassified 3633
138 Ga0466657_210132 3300042582 Bacteria 1433
139 Ga0466690_034122 3300042590 Bacteria 27728
140 Ga0466690_088690 3300042590 Bacteria 3884
141 Ga0466696_056708 3300042596 Bacteria 5276
142 Ga0466731_090532 3300042622 Bacteria 5034
143 Ga0466731_126739 3300042622 Bacteria 2738
144 Ga0466704_069899 3300042643 Bacteria 4387
145 Ga0466705_514322 3300042612 Bacteria 15905
146 Ga0466715_010629 3300042616 Bacteria 6022
147 Ga0466715_262210 3300042616 Bacteria 35550
148 Ga0466728_128512 3300042620 Bacteria 23920
149 Ga0123355_10011638 3300009826 Bacteria 13575
150 Ga0123355_10049914 3300009826 Bacteria 6801
151 Ga0123356_10001311 3300010049 Bacteria 27532
152 Ga0123356_10064946 3300010049 Bacteria 3413
153 Ga0123353_10000106 3300010167 Bacteria 97549
154 Ga0123353_10000793 3300010167 Bacteria 38470
155 Ga0123353_10001029 3300010167 Bacteria 34214
156 Ga0123353_10015732 3300010167 Bacteria 11013
157 Ga0123353_10114566 3300010167 Bacteria 4340
158 Ga0123353_10178305 3300010167 Bacteria 3366
159 Ga0123353_10205692 3300010167 Bacteria 3092
160 IMNBL1DRAFT_c0000088 3300000062 Bacteria 80215
161 IMNBL1DRAFT_c0024052 3300000062 Bacteria 2371
162 JGI24702J35022_10000989 3300002462 Bacteria 17803
163 Ga0068302_10093913 3300005071 Bacteria 5360
164 Ga0466713_060620 3300042602 Bacteria 398690
165 Ga0466717_162690 3300042604 Bacteria 3736
166 Ga0415639_005208 3300038395 Bacteria 17001
167 Ga0415639_018755 3300038395 Bacteria 31667
168 Ga0466690_034466 3300042590 Bacteria 12168
169 Ga0466690_334338 3300042590 Unclassified 3492
170 Ga0466692_131884 3300042591 Bacteria 36723
171 Ga0466691_064323 3300042593 Bacteria 18938
172 Ga0466697_057515 3300042611 Bacteria 1569
173 Ga0466705_168830 3300042612 Bacteria 1880
174 Ga0466735_046209 3300042624 Bacteria 2903
175 Ga0466735_091329 3300042624 Unclassified 3229
176 Ga0466704_335426 3300042643 Bacteria 21031
177 Ga0466708_269269 3300042652 Bacteria 17498
178 Ga0466725_016791 3300042654 Bacteria 21213
179 Ga0466727_195334 3300042655 Bacteria 10771
180 Ga0466715_246868 3300042616 Bacteria 9181
181 Ga0466723_032718 3300042618 Bacteria 7526
182 Ga0466726_068994 3300042619 Bacteria 2074
183 Ga0466726_172208 3300042619 Bacteria 5026
184 Ga0466726_394690 3300042619 Bacteria 3754
185 Ga0123357_10257207 3300009784 Bacteria 1854
186 Ga0123355_10004635 3300009826 Bacteria 20007
187 Ga0123355_10135608 3300009826 Bacteria 3781
188 Ga0123355_10281889 3300009826 Bacteria 2293
189 Ga0123356_10001657 3300010049 Bacteria 24369
190 Ga0123356_10044560 3300010049 Bacteria 4130
191 Ga0123356_10136482 3300010049 Bacteria 2412
192 Ga0123356_10289370 3300010049 Bacteria 1738
193 Ga0123353_10006680 3300010167 Bacteria 15431
194 Ga0123353_10014355 3300010167 Bacteria 11409
195 Ga0123353_10023039 3300010167 Bacteria 9415
196 Ga0123353_10296473 3300010167 Bacteria 2472
197 Ga0123353_10493331 3300010167 Bacteria 1787
198 Ga0123353_10947751 3300010167 Bacteria 1165
199 Ga0123354_10010806 3300010882 Unclassified 14090
200 Ga0123354_10039081 3300010882 Bacteria 7360
201 Ga0123354_10104629 3300010882 Unclassified 3795
202 JGI24695J34938_10000105 3300002450 Bacteria 73971
203 JGI24702J35022_10007095 3300002462 Bacteria 6439
204 Ga0466701_085083 3300042598 Bacteria 6061
205 Ga0466706_241669 3300042599 Bacteria 1699
206 Ga0466707_073729 3300042601 Bacteria 15268
207 Ga0466719_015151 3300042606 Bacteria 3031
208 Ga0415639_005880 3300038395 Bacteria 7097
209 Ga0415639_091240 3300038395 Bacteria 1891
210 Ga0466656_237373 3300042550 Bacteria 15096
211 Ga0466696_055407 3300042596 Bacteria 14085
212 Ga0466696_128152 3300042596 Bacteria 4578
213 Ga0466697_194119 3300042611 Bacteria 1529
214 Ga0466705_013217 3300042612 Bacteria 6141
215 Ga0466705_154633 3300042612 Bacteria 19727
216 Ga0466705_368001 3300042612 Bacteria 17271
217 Ga0466735_228991 3300042624 Bacteria 9990
218 Ga0466703_167106 3300042636 Bacteria 30928
219 Ga0466703_377666 3300042636 Bacteria 3764
220 Ga0466704_413586 3300042643 Bacteria 18227
221 Ga0466708_135099 3300042652 Bacteria 8095
222 Ga0466733_082677 3300042659 Bacteria 8434
223 Ga0466733_209652 3300042659 Bacteria 4574
224 Ga0466715_026497 3300042616 Bacteria 11841
225 Ga0466715_073795 3300042616 Bacteria 5599
226 Ga0466715_331559 3300042616 Bacteria 9298
227 Ga0466723_273783 3300042618 Bacteria 2511
228 Ga0466728_350349 3300042620 Unclassified 2282
229 Ga0123356_10184371 3300010049 Bacteria 2112
230 Ga0123356_10402805 3300010049 Bacteria 1506
231 Ga0123353_10550872 3300010167 Bacteria 1664
232 Ga0123354_10000089 3300010882 Bacteria 67418
233 2227521857 2225789004 Bacteria 17099
234 IMNBGM34_c000615 3300000036 Bacteria 8836
235 JGI24702J35022_10000449 3300002462 Bacteria 24817
236 Ga0123357_10000428 3300009784 Bacteria 40312
237 Ga0466706_084207 3300042599 Bacteria 16962
238 Ga0466700_250348 3300042600 Bacteria 1062
239 Ga0466707_277220 3300042601 Bacteria 1891
240 Ga0466707_313033 3300042601 Bacteria 8653
241 Ga0466717_089344 3300042604 Bacteria 2280
242 Ga0466719_195354 3300042606 Bacteria 2072
243 Ga0466722_266272 3300042609 Bacteria 29442
244 Ga0466698_061604 3300042610 Bacteria 1999
245 Ga0160444_100012 3300012841 Bacteria 428907
246 Ga0466691_094517 3300042593 Bacteria 20478
247 Ga0466696_026254 3300042596 Bacteria 18455
248 Ga0466696_106901 3300042596 Bacteria 16358
249 Ga0466705_152879 3300042612 Bacteria 15102
250 Ga0466705_186278 3300042612 Bacteria 37219
251 Ga0466705_360407 3300042612 Unclassified 10438
252 Ga0466735_033824 3300042624 Bacteria 1303
253 Ga0466703_018188 3300042636 Bacteria 14198
254 Ga0466703_111515 3300042636 Bacteria 19539
255 Ga0466703_368370 3300042636 Bacteria 4262
256 Ga0466704_336788 3300042643 Bacteria 4126
257 Ga0466704_396080 3300042643 Bacteria 7820
258 Ga0466709_229313 3300042648 Bacteria 77880
259 Ga0466708_029214 3300042652 Bacteria 82759
260 Ga0466708_205257 3300042652 Bacteria 30810
261 Ga0466727_087026 3300042655 Bacteria 3941

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF11175 DUF2961 Protein of unknown function (DUF2961) 140 387 0.98

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.