Protein Family IF06085
Metagenome
Isolate
296
Members
88
Samples
261
Scaffolds
370.04
Avg Length
Representative Sequence
- ID
- 3300042602|Ga0466713_064405|Ga0466713_064405_108205_109425
- Length
- 406 aa
- Sequence
- MLPKDTKCKNPFINKYLNHMRSIKLFITVCFALISVCAYTQNYNGLDSNMGNLYMLSNAKTRSISPENFTGEKGKGGMAVPTGERGERNVSNATWAARDLGQGWKVNPFITINSGETFTLAEIEGPGAIQHIWMTPTGNWRFSILRIYWDDEKEPSVECPVGDFFGMGWGVYAPLSSLAVCVNPGSAFNCYWTMPFRKKCRITMENINDAAPMNLYYQIDYALTEVPNDAAYFHAQFRRTNPNATSDYTIIDGIRGKGHYVGIYLAQGVNNNGWWGEGEIKFFMDGDTKFPTICGTGAEDYFCGSYNFDREGQYKEFCTAYAGLHQVIRPDGTYRSQQRFGMYRWHITDPVRFEKDLRITIQDLGWRHGGRYLPQKSDMSSVAFWYQAEPHNKFPKLPVWQELEVN
Sample Types
Isolate
11.8%
Metagenome
88.2%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
28.4%
Termitidae
27.3%
Kalotermitidae
14.8%
Blattidae
13.6%
Rhinotermitidae
4.5%
Termopsidae
4.5%
Passalidae
3.4%
Armadillidiidae
2.3%
Hodotermitidae
1.1%
Taxonomy
Archaea
0
Bacteria
279
Eukaryota
0
Viruses
0
Unclassified
17
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820551407 | Unclassified Firmicutes Emb289P4bin38 | Isolate | Unclassified |
| 2 | 2820623020 | Unclassified Firmicutes Emb289P1bin126 | Isolate | Unclassified |
| 3 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 4 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 5 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 6 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 7 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 8 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 9 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 10 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 11 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 12 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 13 | 2781125693 | Treponema sp. Th196P3bin148 | Isolate | Unclassified |
| 14 | 2820252425 | Unclassified Firmicutes Th196P3bin6 | Isolate | Unclassified |
| 15 | 2820429680 | Unclassified Firmicutes Lab288P3bin30 | Isolate | Unclassified |
| 16 | 2820455747 | Unclassified Firmicutes Lab288P3bin160 | Isolate | Unclassified |
| 17 | 2820541116 | Unclassified Firmicutes Lab288P1bin109 | Isolate | Unclassified |
| 18 | 2820644600 | Unclassified Firmicutes Cu122P5bin39 | Isolate | Unclassified |
| 19 | 2820654856 | Unclassified Firmicutes Cu122P1bin2 | Isolate | Unclassified |
| 20 | 2940313741 | Parabacteroides sp. PH5-17 | Isolate | Blattidae |
| 21 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 22 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 23 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 24 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 25 | 2820336130 | Unclassified Firmicutes Nt197P3bin70 | Isolate | Unclassified |
| 26 | 2940212447 | Parabacteroides sp. PH5-16 | Isolate | Blattidae |
| 27 | 2940302308 | Parabacteroides sp. PF5-5 | Isolate | Blattidae |
| 28 | 2940321370 | Parabacteroides sp. PH5-39 | Isolate | Blattidae |
| 29 | 2940332795 | Parabacteroides sp. PH5-8 | Isolate | Blattidae |
| 30 | 8100166142 | Dysgonomonas sp. GY75 | Isolate | Rhinotermitidae |
| 31 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 32 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 33 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 34 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 35 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 36 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 37 | 3300012841 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E1 MG | Metagenome | Armadillidiidae |
| 38 | 3300012847 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG | Metagenome | Armadillidiidae |
| 39 | 2820414148 | Unclassified Firmicutes Lab288P3bin93 | Isolate | Unclassified |
| 40 | 2820432912 | Unclassified Firmicutes Lab288P3bin219 | Isolate | Unclassified |
| 41 | 2820530790 | Unclassified Firmicutes Lab288P1bin141 | Isolate | Unclassified |
| 42 | 2820657860 | Unclassified Firmicutes Co191P4bin15 | Isolate | Unclassified |
| 43 | 2820663833 | Unclassified Firmicutes Co191P3bin41 | Isolate | Unclassified |
| 44 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 45 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 46 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 47 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 48 | 2781125666 | Treponema sp. Emb289P4bin7 | Isolate | Unclassified |
| 49 | 2820405014 | Unclassified Firmicutes Lab288P4bin88 | Isolate | Unclassified |
| 50 | 2820435670 | Unclassified Firmicutes Lab288P3bin217 | Isolate | Unclassified |
| 51 | 2820698910 | Unclassified Firmicutes Co191P1bin64 | Isolate | Unclassified |
| 52 | 2940306115 | Parabacteroides sp. PFB2-22 | Isolate | Blattidae |
| 53 | 2940309933 | Parabacteroides sp. PH5-13 | Isolate | Blattidae |
| 54 | 2940328985 | Parabacteroides sp. PH5-46 | Isolate | Blattidae |
| 55 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 56 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 57 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 58 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 59 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 60 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 61 | 3300000036 | Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) | Metagenome | Passalidae |
| 62 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 63 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 64 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 65 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 66 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 67 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 68 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 69 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 70 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 71 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 72 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 73 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 74 | 2820362221 | Unclassified Firmicutes Nt197P3bin116 | Isolate | Unclassified |
| 75 | 2940205530 | Parabacteroides sp. PH5-33 | Isolate | Blattidae |
| 76 | 2940317558 | Parabacteroides sp. PH5-26 | Isolate | Blattidae |
| 77 | 2940325180 | Parabacteroides sp. PH5-41 | Isolate | Blattidae |
| 78 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 79 | 2820408893 | Unclassified Firmicutes Lab288P4bin80 | Isolate | Unclassified |
| 80 | 2820200053 | Unclassified Planctomycetes Cu122P5bin40 | Isolate | Unclassified |
| 81 | 2940298504 | Parabacteroides sp. PF5-13 | Isolate | Blattidae |
| 82 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 83 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 84 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 85 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 86 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 87 | 3300002501 | Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 | Metagenome | Termitidae |
| 88 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0123357_10106772 | 3300009784 | Bacteria | 3588 |
| 2 | Ga0123355_10008190 | 3300009826 | Bacteria | 15789 |
| 3 | Ga0123353_10108085 | 3300010167 | Bacteria | 4483 |
| 4 | Ga0123353_10396715 | 3300010167 | Unclassified | 2055 |
| 5 | IMNBL1DRAFT_c0005448 | 3300000062 | Bacteria | 7273 |
| 6 | IMNBL1DRAFT_c0008603 | 3300000062 | Bacteria | 5174 |
| 7 | JGI24702J35022_10009704 | 3300002462 | Bacteria | 5399 |
| 8 | JGI24705J35276_12222691 | 3300002504 | Bacteria | 2443 |
| 9 | Ga0068305_10315735 | 3300005083 | Unclassified | 1534 |
| 10 | Ga0466707_099680 | 3300042601 | Bacteria | 1850 |
| 11 | Ga0466719_358030 | 3300042606 | Bacteria | 1944 |
| 12 | Ga0466722_043134 | 3300042609 | Bacteria | 89421 |
| 13 | Ga0466735_232024 | 3300042624 | Bacteria | 2646 |
| 14 | Ga0466704_065232 | 3300042643 | Bacteria | 37254 |
| 15 | Ga0466704_290667 | 3300042643 | Bacteria | 3798 |
| 16 | Ga0466709_000209 | 3300042648 | Bacteria | 15203 |
| 17 | Ga0466708_238584 | 3300042652 | Bacteria | 14219 |
| 18 | Ga0466727_300187 | 3300042655 | Bacteria | 11290 |
| 19 | Ga0466715_232894 | 3300042616 | Bacteria | 30718 |
| 20 | Ga0466723_061160 | 3300042618 | Bacteria | 19334 |
| 21 | Ga0466729_100998 | 3300042621 | Bacteria | 1843 |
| 22 | Ga0123355_10181401 | 3300009826 | Bacteria | 3124 |
| 23 | Ga0123356_10089743 | 3300010049 | Bacteria | 2925 |
| 24 | Ga0123356_10114219 | 3300010049 | Bacteria | 2614 |
| 25 | Ga0123356_10119020 | 3300010049 | Bacteria | 2565 |
| 26 | Ga0123353_10027860 | 3300010167 | Bacteria | 8666 |
| 27 | Ga0123353_10044208 | 3300010167 | Bacteria | 7060 |
| 28 | Ga0123353_10151945 | 3300010167 | Bacteria | 3695 |
| 29 | Ga0123353_10739210 | 3300010167 | Unclassified | 1372 |
| 30 | Ga0123354_10108432 | 3300010882 | Unclassified | 3688 |
| 31 | 2227584359 | 2225789004 | Bacteria | 2479 |
| 32 | IMNBL1DRAFT_c0008749 | 3300000062 | Bacteria | 5110 |
| 33 | JGI24702J35022_10017795 | 3300002462 | Bacteria | 3880 |
| 34 | JGI24702J35022_10064772 | 3300002462 | Bacteria | 1960 |
| 35 | JGI24696J40584_12960771 | 3300002834 | Bacteria | 8456 |
| 36 | Ga0068305_10005871 | 3300005083 | Bacteria | 24046 |
| 37 | Ga0466700_276236 | 3300042600 | Bacteria | 3462 |
| 38 | Ga0466713_005174 | 3300042602 | Bacteria | 19592 |
| 39 | Ga0466713_152985 | 3300042602 | Bacteria | 166324 |
| 40 | Ga0466716_170551 | 3300042605 | Bacteria | 7788 |
| 41 | Ga0466716_190814 | 3300042605 | Bacteria | 3421 |
| 42 | Ga0466716_246572 | 3300042605 | Bacteria | 16133 |
| 43 | Ga0466719_108955 | 3300042606 | Bacteria | 41298 |
| 44 | Ga0466722_045953 | 3300042609 | Bacteria | 33741 |
| 45 | Ga0415639_129929 | 3300038395 | Bacteria | 3235 |
| 46 | Ga0466690_032396 | 3300042590 | Bacteria | 7575 |
| 47 | Ga0466690_118790 | 3300042590 | Bacteria | 7075 |
| 48 | Ga0466690_156481 | 3300042590 | Bacteria | 32612 |
| 49 | Ga0466705_081179 | 3300042612 | Bacteria | 19501 |
| 50 | Ga0466731_369067 | 3300042622 | Bacteria | 2265 |
| 51 | Ga0466704_048073 | 3300042643 | Bacteria | 3566 |
| 52 | Ga0466704_152823 | 3300042643 | Bacteria | 2222 |
| 53 | Ga0466725_103941 | 3300042654 | Bacteria | 14079 |
| 54 | Ga0466733_197521 | 3300042659 | Bacteria | 10437 |
| 55 | Ga0466715_088356 | 3300042616 | Unclassified | 9585 |
| 56 | Ga0466715_299417 | 3300042616 | Bacteria | 33411 |
| 57 | Ga0466726_239991 | 3300042619 | Bacteria | 5044 |
| 58 | Ga0123357_10016396 | 3300009784 | Bacteria | 9749 |
| 59 | Ga0123357_10024685 | 3300009784 | Bacteria | 8098 |
| 60 | Ga0123357_10247633 | 3300009784 | Bacteria | 1915 |
| 61 | Ga0123355_10046127 | 3300009826 | Bacteria | 7089 |
| 62 | Ga0123355_10239486 | 3300009826 | Bacteria | 2574 |
| 63 | Ga0123355_10264761 | 3300009826 | Bacteria | 2399 |
| 64 | Ga0123356_10008036 | 3300010049 | Bacteria | 10500 |
| 65 | Ga0123356_10026837 | 3300010049 | Bacteria | 5402 |
| 66 | Ga0123356_10058503 | 3300010049 | Bacteria | 3594 |
| 67 | Ga0123353_10000196 | 3300010167 | Bacteria | 76783 |
| 68 | Ga0123353_10006183 | 3300010167 | Bacteria | 15899 |
| 69 | Ga0123353_10075817 | 3300010167 | Bacteria | 5404 |
| 70 | Ga0123353_10127773 | 3300010167 | Bacteria | 4082 |
| 71 | Ga0123353_10234490 | 3300010167 | Bacteria | 2858 |
| 72 | Ga0123353_10658194 | 3300010167 | Bacteria | 1481 |
| 73 | JGI24702J35022_10007786 | 3300002462 | Bacteria | 6113 |
| 74 | JGI24702J35022_10049717 | 3300002462 | Unclassified | 2233 |
| 75 | Ga0466713_064405 | 3300042602 | Bacteria | 152501 |
| 76 | Ga0466716_245165 | 3300042605 | Bacteria | 4293 |
| 77 | Ga0466722_267876 | 3300042609 | Bacteria | 7084 |
| 78 | Ga0160445_101719 | 3300012847 | Bacteria | 5771 |
| 79 | Ga0415639_187417 | 3300038395 | Bacteria | 1714 |
| 80 | Ga0466696_303881 | 3300042596 | Bacteria | 27627 |
| 81 | Ga0466705_087547 | 3300042612 | Unclassified | 8457 |
| 82 | Ga0466703_165890 | 3300042636 | Bacteria | 18285 |
| 83 | Ga0466703_261281 | 3300042636 | Bacteria | 5527 |
| 84 | Ga0466709_357970 | 3300042648 | Bacteria | 46997 |
| 85 | Ga0466715_292557 | 3300042616 | Bacteria | 20428 |
| 86 | Ga0466715_456493 | 3300042616 | Bacteria | 86871 |
| 87 | Ga0466726_397183 | 3300042619 | Bacteria | 3362 |
| 88 | Ga0466728_100856 | 3300042620 | Bacteria | 9839 |
| 89 | Ga0123357_10011684 | 3300009784 | Bacteria | 11281 |
| 90 | Ga0123357_10120364 | 3300009784 | Bacteria | 3309 |
| 91 | Ga0123355_10009869 | 3300009826 | Bacteria | 14567 |
| 92 | Ga0123355_10010916 | 3300009826 | Bacteria | 13977 |
| 93 | Ga0123355_10028001 | 3300009826 | Unclassified | 9109 |
| 94 | Ga0123355_10050266 | 3300009826 | Bacteria | 6774 |
| 95 | Ga0123356_10463359 | 3300010049 | Bacteria | 1417 |
| 96 | Ga0123353_10001551 | 3300010167 | Bacteria | 28152 |
| 97 | Ga0123353_10002521 | 3300010167 | Bacteria | 22757 |
| 98 | Ga0123353_10004846 | 3300010167 | Bacteria | 17484 |
| 99 | IMNBL1DRAFT_c0004188 | 3300000062 | Bacteria | 8767 |
| 100 | JGI24702J35022_10069307 | 3300002462 | Unclassified | 1897 |
| 101 | JGI24703J35330_11589984 | 3300002501 | Bacteria | 1338 |
| 102 | Ga0466707_093107 | 3300042601 | Bacteria | 31059 |
| 103 | Ga0466707_248509 | 3300042601 | Bacteria | 2878 |
| 104 | Ga0466713_087343 | 3300042602 | Bacteria | 44025 |
| 105 | Ga0466719_136473 | 3300042606 | Bacteria | 6100 |
| 106 | Ga0466719_237269 | 3300042606 | Bacteria | 1886 |
| 107 | Ga0415639_043930 | 3300038395 | Bacteria | 12752 |
| 108 | Ga0466694_151302 | 3300042594 | Bacteria | 2291 |
| 109 | Ga0466696_006364 | 3300042596 | Bacteria | 2215 |
| 110 | Ga0466734_171936 | 3300042623 | Bacteria | 1543 |
| 111 | Ga0466702_405196 | 3300042635 | Bacteria | 7505 |
| 112 | Ga0466703_291472 | 3300042636 | Bacteria | 7017 |
| 113 | Ga0466703_418305 | 3300042636 | Bacteria | 1622 |
| 114 | Ga0466704_109926 | 3300042643 | Bacteria | 2843 |
| 115 | Ga0466704_523262 | 3300042643 | Bacteria | 10084 |
| 116 | Ga0466727_030679 | 3300042655 | Bacteria | 2029 |
| 117 | Ga0466727_232063 | 3300042655 | Bacteria | 2121 |
| 118 | Ga0466727_312031 | 3300042655 | Bacteria | 4378 |
| 119 | Ga0466715_036057 | 3300042616 | Bacteria | 24300 |
| 120 | Ga0466726_368877 | 3300042619 | Bacteria | 2339 |
| 121 | Ga0466726_485382 | 3300042619 | Bacteria | 1787 |
| 122 | Ga0466728_032026 | 3300042620 | Bacteria | 3061 |
| 123 | Ga0466728_122619 | 3300042620 | Bacteria | 4569 |
| 124 | Ga0123357_10082424 | 3300009784 | Bacteria | 4223 |
| 125 | Ga0123357_10222232 | 3300009784 | Bacteria | 2092 |
| 126 | Ga0123353_10000174 | 3300010167 | Bacteria | 81672 |
| 127 | Ga0123353_10027145 | 3300010167 | Bacteria | 8769 |
| 128 | Ga0123353_10032285 | 3300010167 | Unclassified | 8128 |
| 129 | Ga0123353_10097348 | 3300010167 | Bacteria | 4742 |
| 130 | Ga0123353_10108382 | 3300010167 | Bacteria | 4476 |
| 131 | Ga0123354_10023449 | 3300010882 | Bacteria | 9733 |
| 132 | IMNBL1DRAFT_c0005521 | 3300000062 | Bacteria | 7206 |
| 133 | JGI24705J35276_12236667 | 3300002504 | Bacteria | 8571 |
| 134 | Ga0466707_145041 | 3300042601 | Bacteria | 1335 |
| 135 | Ga0466713_010003 | 3300042602 | Bacteria | 49152 |
| 136 | Ga0466716_352883 | 3300042605 | Bacteria | 6656 |
| 137 | Ga0466719_040603 | 3300042606 | Unclassified | 3633 |
| 138 | Ga0466657_210132 | 3300042582 | Bacteria | 1433 |
| 139 | Ga0466690_034122 | 3300042590 | Bacteria | 27728 |
| 140 | Ga0466690_088690 | 3300042590 | Bacteria | 3884 |
| 141 | Ga0466696_056708 | 3300042596 | Bacteria | 5276 |
| 142 | Ga0466731_090532 | 3300042622 | Bacteria | 5034 |
| 143 | Ga0466731_126739 | 3300042622 | Bacteria | 2738 |
| 144 | Ga0466704_069899 | 3300042643 | Bacteria | 4387 |
| 145 | Ga0466705_514322 | 3300042612 | Bacteria | 15905 |
| 146 | Ga0466715_010629 | 3300042616 | Bacteria | 6022 |
| 147 | Ga0466715_262210 | 3300042616 | Bacteria | 35550 |
| 148 | Ga0466728_128512 | 3300042620 | Bacteria | 23920 |
| 149 | Ga0123355_10011638 | 3300009826 | Bacteria | 13575 |
| 150 | Ga0123355_10049914 | 3300009826 | Bacteria | 6801 |
| 151 | Ga0123356_10001311 | 3300010049 | Bacteria | 27532 |
| 152 | Ga0123356_10064946 | 3300010049 | Bacteria | 3413 |
| 153 | Ga0123353_10000106 | 3300010167 | Bacteria | 97549 |
| 154 | Ga0123353_10000793 | 3300010167 | Bacteria | 38470 |
| 155 | Ga0123353_10001029 | 3300010167 | Bacteria | 34214 |
| 156 | Ga0123353_10015732 | 3300010167 | Bacteria | 11013 |
| 157 | Ga0123353_10114566 | 3300010167 | Bacteria | 4340 |
| 158 | Ga0123353_10178305 | 3300010167 | Bacteria | 3366 |
| 159 | Ga0123353_10205692 | 3300010167 | Bacteria | 3092 |
| 160 | IMNBL1DRAFT_c0000088 | 3300000062 | Bacteria | 80215 |
| 161 | IMNBL1DRAFT_c0024052 | 3300000062 | Bacteria | 2371 |
| 162 | JGI24702J35022_10000989 | 3300002462 | Bacteria | 17803 |
| 163 | Ga0068302_10093913 | 3300005071 | Bacteria | 5360 |
| 164 | Ga0466713_060620 | 3300042602 | Bacteria | 398690 |
| 165 | Ga0466717_162690 | 3300042604 | Bacteria | 3736 |
| 166 | Ga0415639_005208 | 3300038395 | Bacteria | 17001 |
| 167 | Ga0415639_018755 | 3300038395 | Bacteria | 31667 |
| 168 | Ga0466690_034466 | 3300042590 | Bacteria | 12168 |
| 169 | Ga0466690_334338 | 3300042590 | Unclassified | 3492 |
| 170 | Ga0466692_131884 | 3300042591 | Bacteria | 36723 |
| 171 | Ga0466691_064323 | 3300042593 | Bacteria | 18938 |
| 172 | Ga0466697_057515 | 3300042611 | Bacteria | 1569 |
| 173 | Ga0466705_168830 | 3300042612 | Bacteria | 1880 |
| 174 | Ga0466735_046209 | 3300042624 | Bacteria | 2903 |
| 175 | Ga0466735_091329 | 3300042624 | Unclassified | 3229 |
| 176 | Ga0466704_335426 | 3300042643 | Bacteria | 21031 |
| 177 | Ga0466708_269269 | 3300042652 | Bacteria | 17498 |
| 178 | Ga0466725_016791 | 3300042654 | Bacteria | 21213 |
| 179 | Ga0466727_195334 | 3300042655 | Bacteria | 10771 |
| 180 | Ga0466715_246868 | 3300042616 | Bacteria | 9181 |
| 181 | Ga0466723_032718 | 3300042618 | Bacteria | 7526 |
| 182 | Ga0466726_068994 | 3300042619 | Bacteria | 2074 |
| 183 | Ga0466726_172208 | 3300042619 | Bacteria | 5026 |
| 184 | Ga0466726_394690 | 3300042619 | Bacteria | 3754 |
| 185 | Ga0123357_10257207 | 3300009784 | Bacteria | 1854 |
| 186 | Ga0123355_10004635 | 3300009826 | Bacteria | 20007 |
| 187 | Ga0123355_10135608 | 3300009826 | Bacteria | 3781 |
| 188 | Ga0123355_10281889 | 3300009826 | Bacteria | 2293 |
| 189 | Ga0123356_10001657 | 3300010049 | Bacteria | 24369 |
| 190 | Ga0123356_10044560 | 3300010049 | Bacteria | 4130 |
| 191 | Ga0123356_10136482 | 3300010049 | Bacteria | 2412 |
| 192 | Ga0123356_10289370 | 3300010049 | Bacteria | 1738 |
| 193 | Ga0123353_10006680 | 3300010167 | Bacteria | 15431 |
| 194 | Ga0123353_10014355 | 3300010167 | Bacteria | 11409 |
| 195 | Ga0123353_10023039 | 3300010167 | Bacteria | 9415 |
| 196 | Ga0123353_10296473 | 3300010167 | Bacteria | 2472 |
| 197 | Ga0123353_10493331 | 3300010167 | Bacteria | 1787 |
| 198 | Ga0123353_10947751 | 3300010167 | Bacteria | 1165 |
| 199 | Ga0123354_10010806 | 3300010882 | Unclassified | 14090 |
| 200 | Ga0123354_10039081 | 3300010882 | Bacteria | 7360 |
| 201 | Ga0123354_10104629 | 3300010882 | Unclassified | 3795 |
| 202 | JGI24695J34938_10000105 | 3300002450 | Bacteria | 73971 |
| 203 | JGI24702J35022_10007095 | 3300002462 | Bacteria | 6439 |
| 204 | Ga0466701_085083 | 3300042598 | Bacteria | 6061 |
| 205 | Ga0466706_241669 | 3300042599 | Bacteria | 1699 |
| 206 | Ga0466707_073729 | 3300042601 | Bacteria | 15268 |
| 207 | Ga0466719_015151 | 3300042606 | Bacteria | 3031 |
| 208 | Ga0415639_005880 | 3300038395 | Bacteria | 7097 |
| 209 | Ga0415639_091240 | 3300038395 | Bacteria | 1891 |
| 210 | Ga0466656_237373 | 3300042550 | Bacteria | 15096 |
| 211 | Ga0466696_055407 | 3300042596 | Bacteria | 14085 |
| 212 | Ga0466696_128152 | 3300042596 | Bacteria | 4578 |
| 213 | Ga0466697_194119 | 3300042611 | Bacteria | 1529 |
| 214 | Ga0466705_013217 | 3300042612 | Bacteria | 6141 |
| 215 | Ga0466705_154633 | 3300042612 | Bacteria | 19727 |
| 216 | Ga0466705_368001 | 3300042612 | Bacteria | 17271 |
| 217 | Ga0466735_228991 | 3300042624 | Bacteria | 9990 |
| 218 | Ga0466703_167106 | 3300042636 | Bacteria | 30928 |
| 219 | Ga0466703_377666 | 3300042636 | Bacteria | 3764 |
| 220 | Ga0466704_413586 | 3300042643 | Bacteria | 18227 |
| 221 | Ga0466708_135099 | 3300042652 | Bacteria | 8095 |
| 222 | Ga0466733_082677 | 3300042659 | Bacteria | 8434 |
| 223 | Ga0466733_209652 | 3300042659 | Bacteria | 4574 |
| 224 | Ga0466715_026497 | 3300042616 | Bacteria | 11841 |
| 225 | Ga0466715_073795 | 3300042616 | Bacteria | 5599 |
| 226 | Ga0466715_331559 | 3300042616 | Bacteria | 9298 |
| 227 | Ga0466723_273783 | 3300042618 | Bacteria | 2511 |
| 228 | Ga0466728_350349 | 3300042620 | Unclassified | 2282 |
| 229 | Ga0123356_10184371 | 3300010049 | Bacteria | 2112 |
| 230 | Ga0123356_10402805 | 3300010049 | Bacteria | 1506 |
| 231 | Ga0123353_10550872 | 3300010167 | Bacteria | 1664 |
| 232 | Ga0123354_10000089 | 3300010882 | Bacteria | 67418 |
| 233 | 2227521857 | 2225789004 | Bacteria | 17099 |
| 234 | IMNBGM34_c000615 | 3300000036 | Bacteria | 8836 |
| 235 | JGI24702J35022_10000449 | 3300002462 | Bacteria | 24817 |
| 236 | Ga0123357_10000428 | 3300009784 | Bacteria | 40312 |
| 237 | Ga0466706_084207 | 3300042599 | Bacteria | 16962 |
| 238 | Ga0466700_250348 | 3300042600 | Bacteria | 1062 |
| 239 | Ga0466707_277220 | 3300042601 | Bacteria | 1891 |
| 240 | Ga0466707_313033 | 3300042601 | Bacteria | 8653 |
| 241 | Ga0466717_089344 | 3300042604 | Bacteria | 2280 |
| 242 | Ga0466719_195354 | 3300042606 | Bacteria | 2072 |
| 243 | Ga0466722_266272 | 3300042609 | Bacteria | 29442 |
| 244 | Ga0466698_061604 | 3300042610 | Bacteria | 1999 |
| 245 | Ga0160444_100012 | 3300012841 | Bacteria | 428907 |
| 246 | Ga0466691_094517 | 3300042593 | Bacteria | 20478 |
| 247 | Ga0466696_026254 | 3300042596 | Bacteria | 18455 |
| 248 | Ga0466696_106901 | 3300042596 | Bacteria | 16358 |
| 249 | Ga0466705_152879 | 3300042612 | Bacteria | 15102 |
| 250 | Ga0466705_186278 | 3300042612 | Bacteria | 37219 |
| 251 | Ga0466705_360407 | 3300042612 | Unclassified | 10438 |
| 252 | Ga0466735_033824 | 3300042624 | Bacteria | 1303 |
| 253 | Ga0466703_018188 | 3300042636 | Bacteria | 14198 |
| 254 | Ga0466703_111515 | 3300042636 | Bacteria | 19539 |
| 255 | Ga0466703_368370 | 3300042636 | Bacteria | 4262 |
| 256 | Ga0466704_336788 | 3300042643 | Bacteria | 4126 |
| 257 | Ga0466704_396080 | 3300042643 | Bacteria | 7820 |
| 258 | Ga0466709_229313 | 3300042648 | Bacteria | 77880 |
| 259 | Ga0466708_029214 | 3300042652 | Bacteria | 82759 |
| 260 | Ga0466708_205257 | 3300042652 | Bacteria | 30810 |
| 261 | Ga0466727_087026 | 3300042655 | Bacteria | 3941 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF11175 | DUF2961 | Protein of unknown function (DUF2961) | 140 | 387 | 0.98 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.