Protein Family IF06045
Metagenome
Isolate
289
Members
92
Samples
257
Scaffolds
324.16
Avg Length
Representative Sequence
- ID
- 3300042602|Ga0466713_029120|Ga0466713_029120_1314_2423
- Length
- 369 aa
- Sequence
- LSTSKKNLPFFGLFIVFLYLCNLFSNYSSVKDTAYLLYYYCRMRENLLHVSGSPHVHSQDSVKKIMWSVVIALVPAFVVSVLVFGLPVLWVTATSIGTCLAVEYLIQRFLLKGKSTLWDGSAVITGLLLAFNLPANLPLWLVVIGGIVSIGIAKMAFGGLGNNPFNPALVGRVFLLISFPVQMTTWPKAIATWGGGDIITGPTPLALLKEGVKNGDTVSSLLPEMPSYLQMLTGQMGGSFGEISAIALLAGALFLLIRKVITWHIPVAFLLSAFLFSGIFWLVNPEVYANPCFHLLTGGMMLGALFMATDMVTSPITPLGMIIFGCGCGILTILIRLFGAYPEGCSFAILIMNAVVPLLNRWFKPKSFA
Sample Types
Isolate
11.1%
Metagenome
88.9%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
34.1%
Blattidae
22.0%
Unclassified
16.5%
Kalotermitidae
15.4%
Termopsidae
4.4%
Passalidae
3.3%
Rhinotermitidae
3.3%
Hodotermitidae
1.1%
Taxonomy
Archaea
0
Bacteria
280
Eukaryota
0
Viruses
0
Unclassified
9
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2920168565 | Paludibacter sp. 221 | Isolate | Blattidae |
| 2 | 2940205530 | Parabacteroides sp. PH5-33 | Isolate | Blattidae |
| 3 | 2940216256 | Dysgonomonadaceae bacterium PH5-43 | Isolate | Blattidae |
| 4 | 2940317558 | Parabacteroides sp. PH5-26 | Isolate | Blattidae |
| 5 | 2940325180 | Parabacteroides sp. PH5-41 | Isolate | Blattidae |
| 6 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 7 | 2923982719 | Parabacteroides sp. 52 | Isolate | Blattidae |
| 8 | 2940306115 | Parabacteroides sp. PFB2-22 | Isolate | Blattidae |
| 9 | 2940309933 | Parabacteroides sp. PH5-13 | Isolate | Blattidae |
| 10 | 2940328985 | Parabacteroides sp. PH5-46 | Isolate | Blattidae |
| 11 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 12 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 13 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 14 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 15 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 16 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 17 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 18 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 19 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 20 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 21 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 22 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 23 | 2940195863 | Parabacteroides sp. PF5-6 | Isolate | Blattidae |
| 24 | 2940209341 | Parabacteroides sp. PFB2-10 | Isolate | Blattidae |
| 25 | 2940298504 | Parabacteroides sp. PF5-13 | Isolate | Blattidae |
| 26 | 2820736622 | Unclassified Bacteroidetes Th196P4bin26 | Isolate | Unclassified |
| 27 | 2820753519 | Unclassified Bacteroidetes Nc150P4bin20 | Isolate | Unclassified |
| 28 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 29 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 30 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 31 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 32 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 33 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 34 | 2940212447 | Parabacteroides sp. PH5-16 | Isolate | Blattidae |
| 35 | 2940302308 | Parabacteroides sp. PF5-5 | Isolate | Blattidae |
| 36 | 2940321370 | Parabacteroides sp. PH5-39 | Isolate | Blattidae |
| 37 | 2225789003 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) | Metagenome | Passalidae |
| 38 | 2820735654 | Unclassified Bacteroidetes Th196P4bin9 | Isolate | Unclassified |
| 39 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 40 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 41 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 42 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 43 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 44 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 45 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 46 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 47 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 48 | 2820757377 | Unclassified Bacteroidetes Mp193P4bin6 | Isolate | Unclassified |
| 49 | 2820783511 | Unclassified Bacteroidetes Emb289P3bin108 | Isolate | Unclassified |
| 50 | 2940199050 | Parabacteroides sp. PM6-13 | Isolate | Blattidae |
| 51 | 2940202316 | Parabacteroides sp. PF5-9 | Isolate | Blattidae |
| 52 | 2940371297 | Parabacteroides sp. PM5-20 | Isolate | Blattidae |
| 53 | 2820750388 | Unclassified Bacteroidetes Nt197P3bin50 | Isolate | Unclassified |
| 54 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 55 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 56 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 57 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 58 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 59 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 60 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 61 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 62 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 63 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 64 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 65 | 2820792843 | Unclassified Bacteroidetes Cu122P3bin1 | Isolate | Unclassified |
| 66 | 2940346213 | Parabacteroides sp. PFB2-12 | Isolate | Blattidae |
| 67 | 2820740053 | Unclassified Bacteroidetes Th196P3bin81 | Isolate | Unclassified |
| 68 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 69 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 70 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 71 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 72 | 2820768849 | Unclassified Bacteroidetes Lab288P3bin194 | Isolate | Unclassified |
| 73 | 2820774381 | Unclassified Bacteroidetes Lab288P1bin37 | Isolate | Unclassified |
| 74 | 2940313741 | Parabacteroides sp. PH5-17 | Isolate | Blattidae |
| 75 | 2820755292 | Unclassified Bacteroidetes Nc150P3bin3 | Isolate | Unclassified |
| 76 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 77 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 78 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 79 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 80 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 81 | 2820744581 | Unclassified Bacteroidetes Th196P3bin138 | Isolate | Unclassified |
| 82 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 83 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 84 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 85 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 86 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 87 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 88 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 89 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 90 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 91 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 92 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466732_261268 | 3300042656 | Bacteria | 5072 |
| 2 | Ga0466733_038948 | 3300042659 | Bacteria | 6089 |
| 3 | Ga0466710_147433 | 3300042613 | Bacteria | 3751 |
| 4 | Ga0466715_055007 | 3300042616 | Bacteria | 10861 |
| 5 | Ga0466735_108901 | 3300042624 | Bacteria | 1641 |
| 6 | Ga0466703_406557 | 3300042636 | Bacteria | 6300 |
| 7 | Ga0466704_086702 | 3300042643 | Bacteria | 9037 |
| 8 | Ga0466704_113992 | 3300042643 | Bacteria | 17348 |
| 9 | Ga0466708_434097 | 3300042652 | Bacteria | 5724 |
| 10 | Ga0466690_021283 | 3300042590 | Bacteria | 4975 |
| 11 | Ga0466691_111791 | 3300042593 | Bacteria | 4740 |
| 12 | Ga0466691_161197 | 3300042593 | Bacteria | 4006 |
| 13 | Ga0466696_050124 | 3300042596 | Bacteria | 20961 |
| 14 | Ga0466701_034795 | 3300042598 | Bacteria | 1742 |
| 15 | Ga0466706_122623 | 3300042599 | Bacteria | 44263 |
| 16 | Ga0466706_159962 | 3300042599 | Bacteria | 31433 |
| 17 | Ga0466706_249268 | 3300042599 | Bacteria | 84594 |
| 18 | Ga0466707_188786 | 3300042601 | Bacteria | 4565 |
| 19 | Ga0466716_329348 | 3300042605 | Bacteria | 11011 |
| 20 | Ga0466719_121128 | 3300042606 | Bacteria | 5948 |
| 21 | Ga0466719_304524 | 3300042606 | Bacteria | 1645 |
| 22 | Ga0466719_325683 | 3300042606 | Bacteria | 5356 |
| 23 | Ga0123356_10030873 | 3300010049 | Bacteria | 5013 |
| 24 | Ga0123353_10250828 | 3300010167 | Bacteria | 2741 |
| 25 | JGI24702J35022_10000285 | 3300002462 | Bacteria | 29611 |
| 26 | Ga0072940_1193041 | 3300005200 | Bacteria | 1613 |
| 27 | Ga0072941_1308119 | 3300005201 | Bacteria | 4615 |
| 28 | Ga0466697_163525 | 3300042611 | Unclassified | 1428 |
| 29 | Ga0466705_123909 | 3300042612 | Bacteria | 5169 |
| 30 | Ga0466705_228317 | 3300042612 | Bacteria | 15369 |
| 31 | Ga0466733_108832 | 3300042659 | Bacteria | 18233 |
| 32 | Ga0466733_171847 | 3300042659 | Bacteria | 8546 |
| 33 | Ga0466733_181113 | 3300042659 | Bacteria | 25202 |
| 34 | Ga0466710_186698 | 3300042613 | Bacteria | 2354 |
| 35 | Ga0466711_025840 | 3300042615 | Bacteria | 5373 |
| 36 | Ga0466723_113884 | 3300042618 | Bacteria | 2164 |
| 37 | Ga0466723_153709 | 3300042618 | Bacteria | 20208 |
| 38 | Ga0466723_331208 | 3300042618 | Bacteria | 17667 |
| 39 | Ga0466726_354402 | 3300042619 | Bacteria | 3137 |
| 40 | Ga0466726_410730 | 3300042619 | Bacteria | 4964 |
| 41 | Ga0466729_191748 | 3300042621 | Bacteria | 8466 |
| 42 | Ga0466731_004794 | 3300042622 | Bacteria | 1500 |
| 43 | Ga0466735_001507 | 3300042624 | Bacteria | 4373 |
| 44 | Ga0466735_125277 | 3300042624 | Bacteria | 1887 |
| 45 | Ga0466703_014305 | 3300042636 | Bacteria | 6032 |
| 46 | Ga0466703_400304 | 3300042636 | Bacteria | 16695 |
| 47 | Ga0466709_257026 | 3300042648 | Bacteria | 19904 |
| 48 | Ga0466709_267738 | 3300042648 | Bacteria | 7120 |
| 49 | Ga0466690_039030 | 3300042590 | Bacteria | 4929 |
| 50 | Ga0466690_066012 | 3300042590 | Bacteria | 9992 |
| 51 | Ga0466691_020566 | 3300042593 | Bacteria | 4018 |
| 52 | Ga0466695_212805 | 3300042595 | Bacteria | 1502 |
| 53 | Ga0466706_013829 | 3300042599 | Bacteria | 33879 |
| 54 | Ga0466706_129682 | 3300042599 | Bacteria | 50477 |
| 55 | Ga0466706_187896 | 3300042599 | Bacteria | 14775 |
| 56 | Ga0466706_229231 | 3300042599 | Bacteria | 3521 |
| 57 | Ga0466707_241759 | 3300042601 | Bacteria | 17311 |
| 58 | Ga0466713_058490 | 3300042602 | Bacteria | 7055 |
| 59 | Ga0466714_036447 | 3300042603 | Bacteria | 5353 |
| 60 | Ga0466714_075662 | 3300042603 | Bacteria | 4333 |
| 61 | Ga0466714_091138 | 3300042603 | Bacteria | 6060 |
| 62 | Ga0466716_242680 | 3300042605 | Bacteria | 20394 |
| 63 | Ga0466721_313992 | 3300042608 | Bacteria | 6964 |
| 64 | Ga0466698_050436 | 3300042610 | Bacteria | 2050 |
| 65 | Ga0123356_10044584 | 3300010049 | Bacteria | 4128 |
| 66 | Ga0123356_10070707 | 3300010049 | Bacteria | 3274 |
| 67 | Ga0123353_10000005 | 3300010167 | Bacteria | 308504 |
| 68 | Ga0123353_10005921 | 3300010167 | Bacteria | 16171 |
| 69 | Ga0123353_10009269 | 3300010167 | Bacteria | 13555 |
| 70 | Ga0123353_10030606 | 3300010167 | Bacteria | 8321 |
| 71 | Ga0123353_10109431 | 3300010167 | Unclassified | 4452 |
| 72 | Ga0123353_10114022 | 3300010167 | Bacteria | 4351 |
| 73 | Ga0123353_10233950 | 3300010167 | Bacteria | 2862 |
| 74 | IMNBL1DRAFT_c0003177 | 3300000062 | Bacteria | 10776 |
| 75 | JGI24702J35022_10032786 | 3300002462 | Bacteria | 2779 |
| 76 | Ga0068305_10149672 | 3300005083 | Bacteria | 1413 |
| 77 | Ga0466705_242421 | 3300042612 | Bacteria | 31459 |
| 78 | Ga0466733_067801 | 3300042659 | Bacteria | 1044 |
| 79 | Ga0466715_351519 | 3300042616 | Bacteria | 2507 |
| 80 | Ga0466726_195144 | 3300042619 | Bacteria | 2297 |
| 81 | Ga0466726_372191 | 3300042619 | Bacteria | 1431 |
| 82 | Ga0466729_253684 | 3300042621 | Bacteria | 8951 |
| 83 | Ga0466735_013925 | 3300042624 | Bacteria | 5676 |
| 84 | Ga0466735_025506 | 3300042624 | Bacteria | 53656 |
| 85 | Ga0466703_057153 | 3300042636 | Bacteria | 14977 |
| 86 | Ga0466708_232699 | 3300042652 | Bacteria | 12793 |
| 87 | Ga0466708_367530 | 3300042652 | Bacteria | 33206 |
| 88 | Ga0466691_096039 | 3300042593 | Bacteria | 8176 |
| 89 | Ga0466694_270503 | 3300042594 | Bacteria | 11477 |
| 90 | Ga0466696_128594 | 3300042596 | Bacteria | 10984 |
| 91 | Ga0466701_042538 | 3300042598 | Bacteria | 2048 |
| 92 | Ga0466707_354529 | 3300042601 | Bacteria | 4084 |
| 93 | Ga0466714_044224 | 3300042603 | Bacteria | 3628 |
| 94 | Ga0466714_165186 | 3300042603 | Bacteria | 21521 |
| 95 | Ga0466722_113848 | 3300042609 | Bacteria | 5259 |
| 96 | Ga0466722_206155 | 3300042609 | Bacteria | 7422 |
| 97 | Ga0123356_10101543 | 3300010049 | Bacteria | 2760 |
| 98 | Ga0123353_10157641 | 3300010167 | Bacteria | 3616 |
| 99 | IMNBL1DRAFT_c0032151 | 3300000062 | Unclassified | 1896 |
| 100 | JGI24702J35022_10001179 | 3300002462 | Bacteria | 16274 |
| 101 | JGI24702J35022_10092839 | 3300002462 | Bacteria | 1645 |
| 102 | Ga0072940_1174624 | 3300005200 | Bacteria | 2464 |
| 103 | Ga0466733_123446 | 3300042659 | Bacteria | 50285 |
| 104 | Ga0466733_149778 | 3300042659 | Bacteria | 16526 |
| 105 | Ga0466705_396614 | 3300042612 | Bacteria | 2875 |
| 106 | Ga0466711_089117 | 3300042615 | Bacteria | 39213 |
| 107 | Ga0466711_238407 | 3300042615 | Bacteria | 19267 |
| 108 | Ga0466711_381928 | 3300042615 | Unclassified | 1902 |
| 109 | Ga0466715_593195 | 3300042616 | Bacteria | 30381 |
| 110 | Ga0466723_269634 | 3300042618 | Bacteria | 4627 |
| 111 | Ga0466726_083228 | 3300042619 | Bacteria | 9753 |
| 112 | Ga0466702_087693 | 3300042635 | Bacteria | 1132 |
| 113 | Ga0466703_029735 | 3300042636 | Bacteria | 12751 |
| 114 | Ga0466709_014514 | 3300042648 | Bacteria | 492815 |
| 115 | Ga0466708_133356 | 3300042652 | Bacteria | 6121 |
| 116 | Ga0466708_235488 | 3300042652 | Bacteria | 24641 |
| 117 | Ga0466727_055911 | 3300042655 | Bacteria | 9680 |
| 118 | Ga0466690_080531 | 3300042590 | Bacteria | 13623 |
| 119 | Ga0466690_087595 | 3300042590 | Bacteria | 13158 |
| 120 | Ga0466691_002391 | 3300042593 | Bacteria | 13503 |
| 121 | Ga0466694_332416 | 3300042594 | Bacteria | 4016 |
| 122 | Ga0466696_415179 | 3300042596 | Bacteria | 2827 |
| 123 | Ga0466706_051177 | 3300042599 | Bacteria | 66113 |
| 124 | Ga0466706_054783 | 3300042599 | Bacteria | 12202 |
| 125 | Ga0466706_105861 | 3300042599 | Bacteria | 38646 |
| 126 | Ga0466706_165084 | 3300042599 | Bacteria | 195712 |
| 127 | Ga0466706_278104 | 3300042599 | Bacteria | 62605 |
| 128 | Ga0466700_190018 | 3300042600 | Bacteria | 1095 |
| 129 | Ga0466707_020660 | 3300042601 | Bacteria | 5596 |
| 130 | Ga0466713_063363 | 3300042602 | Bacteria | 50941 |
| 131 | Ga0466713_063837 | 3300042602 | Bacteria | 17219 |
| 132 | Ga0466714_096730 | 3300042603 | Bacteria | 5349 |
| 133 | Ga0466714_118026 | 3300042603 | Bacteria | 60394 |
| 134 | Ga0466720_000405 | 3300042607 | Bacteria | 4699 |
| 135 | Ga0466722_119028 | 3300042609 | Bacteria | 2302 |
| 136 | Ga0123355_10176201 | 3300009826 | Bacteria | 3184 |
| 137 | Ga0123355_10480839 | 3300009826 | Bacteria | 1545 |
| 138 | Ga0123356_10017290 | 3300010049 | Bacteria | 6862 |
| 139 | Ga0123353_10428054 | 3300010167 | Bacteria | 1958 |
| 140 | Ga0068302_10105798 | 3300005071 | Bacteria | 2519 |
| 141 | Ga0466733_164309 | 3300042659 | Bacteria | 5753 |
| 142 | Ga0466710_120452 | 3300042613 | Bacteria | 3072 |
| 143 | Ga0466711_042257 | 3300042615 | Bacteria | 4515 |
| 144 | Ga0466715_051157 | 3300042616 | Bacteria | 50381 |
| 145 | Ga0466728_057961 | 3300042620 | Bacteria | 56835 |
| 146 | Ga0466703_225930 | 3300042636 | Bacteria | 8188 |
| 147 | Ga0466704_039848 | 3300042643 | Bacteria | 5789 |
| 148 | Ga0466709_228700 | 3300042648 | Bacteria | 33858 |
| 149 | Ga0466708_242242 | 3300042652 | Bacteria | 10160 |
| 150 | Ga0466692_119198 | 3300042591 | Bacteria | 36892 |
| 151 | Ga0466694_063351 | 3300042594 | Bacteria | 6430 |
| 152 | Ga0466696_055678 | 3300042596 | Bacteria | 26301 |
| 153 | Ga0466696_317252 | 3300042596 | Bacteria | 26380 |
| 154 | Ga0466701_017750 | 3300042598 | Bacteria | 34255 |
| 155 | Ga0466706_155793 | 3300042599 | Bacteria | 34721 |
| 156 | Ga0466706_184722 | 3300042599 | Bacteria | 2437 |
| 157 | Ga0466707_130825 | 3300042601 | Bacteria | 5810 |
| 158 | Ga0466707_188458 | 3300042601 | Bacteria | 1203 |
| 159 | Ga0466713_024740 | 3300042602 | Bacteria | 43594 |
| 160 | Ga0466713_060923 | 3300042602 | Bacteria | 31691 |
| 161 | Ga0466714_023886 | 3300042603 | Bacteria | 17040 |
| 162 | Ga0466714_142234 | 3300042603 | Bacteria | 1568 |
| 163 | Ga0123353_10058774 | 3300010167 | Bacteria | 6162 |
| 164 | Ga0123354_10018124 | 3300010882 | Bacteria | 11037 |
| 165 | Ga0123354_10284007 | 3300010882 | Bacteria | 1601 |
| 166 | 2227531581 | 2225789004 | Bacteria | 3142 |
| 167 | JGI24705J35276_12205359 | 3300002504 | Bacteria | 1696 |
| 168 | Ga0466697_171514 | 3300042611 | Bacteria | 3889 |
| 169 | Ga0466705_046113 | 3300042612 | Bacteria | 5566 |
| 170 | Ga0466732_188749 | 3300042656 | Bacteria | 1601 |
| 171 | Ga0466733_003998 | 3300042659 | Unclassified | 8746 |
| 172 | Ga0466733_180957 | 3300042659 | Bacteria | 1866 |
| 173 | Ga0466733_196102 | 3300042659 | Bacteria | 12316 |
| 174 | Ga0466711_027701 | 3300042615 | Bacteria | 5289 |
| 175 | Ga0466715_525255 | 3300042616 | Bacteria | 8687 |
| 176 | Ga0466723_216363 | 3300042618 | Bacteria | 9719 |
| 177 | Ga0466726_031977 | 3300042619 | Bacteria | 2213 |
| 178 | Ga0466728_022023 | 3300042620 | Bacteria | 23716 |
| 179 | Ga0466729_074520 | 3300042621 | Bacteria | 2535 |
| 180 | Ga0466729_267168 | 3300042621 | Bacteria | 2389 |
| 181 | Ga0466734_167346 | 3300042623 | Bacteria | 1763 |
| 182 | Ga0466703_148567 | 3300042636 | Bacteria | 10604 |
| 183 | Ga0466709_064425 | 3300042648 | Bacteria | 43572 |
| 184 | Ga0466708_347209 | 3300042652 | Bacteria | 9218 |
| 185 | Ga0466727_173972 | 3300042655 | Bacteria | 11139 |
| 186 | Ga0466690_277192 | 3300042590 | Bacteria | 9343 |
| 187 | Ga0466690_327331 | 3300042590 | Bacteria | 9582 |
| 188 | Ga0466692_167122 | 3300042591 | Bacteria | 23846 |
| 189 | Ga0466693_111844 | 3300042592 | Bacteria | 2030 |
| 190 | Ga0466695_307973 | 3300042595 | Bacteria | 10017 |
| 191 | Ga0466713_029120 | 3300042602 | Bacteria | 25153 |
| 192 | Ga0466717_097492 | 3300042604 | Unclassified | 1481 |
| 193 | Ga0466716_326513 | 3300042605 | Bacteria | 5677 |
| 194 | Ga0466716_395281 | 3300042605 | Bacteria | 3272 |
| 195 | Ga0466722_151487 | 3300042609 | Bacteria | 2359 |
| 196 | Ga0466698_041143 | 3300042610 | Bacteria | 3326 |
| 197 | Ga0466698_324453 | 3300042610 | Bacteria | 2486 |
| 198 | Ga0123353_10789890 | 3300010167 | Bacteria | 1313 |
| 199 | Ga0068302_10107728 | 3300005071 | Bacteria | 3894 |
| 200 | Ga0466697_129388 | 3300042611 | Bacteria | 2419 |
| 201 | Ga0466727_351952 | 3300042655 | Bacteria | 33342 |
| 202 | Ga0466733_022311 | 3300042659 | Bacteria | 3056 |
| 203 | Ga0466711_052452 | 3300042615 | Bacteria | 4918 |
| 204 | Ga0466711_096964 | 3300042615 | Bacteria | 2079 |
| 205 | Ga0466718_069460 | 3300042617 | Bacteria | 1107 |
| 206 | Ga0466726_128562 | 3300042619 | Bacteria | 14247 |
| 207 | Ga0466731_235359 | 3300042622 | Bacteria | 5787 |
| 208 | Ga0466709_032800 | 3300042648 | Bacteria | 2095 |
| 209 | Ga0466724_15292 | 3300042649 | Bacteria | 3400 |
| 210 | Ga0466657_206832 | 3300042582 | Bacteria | 21459 |
| 211 | Ga0466696_096309 | 3300042596 | Bacteria | 16603 |
| 212 | Ga0466696_500331 | 3300042596 | Bacteria | 32699 |
| 213 | Ga0466699_274728 | 3300042597 | Bacteria | 1914 |
| 214 | Ga0466706_027450 | 3300042599 | Bacteria | 28651 |
| 215 | Ga0466714_006756 | 3300042603 | Bacteria | 211810 |
| 216 | Ga0466714_047960 | 3300042603 | Bacteria | 2849 |
| 217 | Ga0466714_136809 | 3300042603 | Bacteria | 1785 |
| 218 | Ga0466719_130583 | 3300042606 | Bacteria | 12871 |
| 219 | Ga0123355_10016740 | 3300009826 | Bacteria | 11569 |
| 220 | Ga0123356_10168134 | 3300010049 | Bacteria | 2200 |
| 221 | Ga0123356_10478533 | 3300010049 | Bacteria | 1398 |
| 222 | Ga0123353_10661298 | 3300010167 | Bacteria | 1476 |
| 223 | 2226980369 | 2225789003 | Bacteria | 34607 |
| 224 | JGI24699J35502_11133978 | 3300002509 | Bacteria | 22406 |
| 225 | JGI24696J40584_12961451 | 3300002834 | Bacteria | 16534 |
| 226 | Ga0068302_10563484 | 3300005071 | Unclassified | 1830 |
| 227 | Ga0466733_012710 | 3300042659 | Bacteria | 11988 |
| 228 | Ga0466733_110982 | 3300042659 | Bacteria | 43063 |
| 229 | Ga0466733_144095 | 3300042659 | Bacteria | 2186 |
| 230 | Ga0466733_153153 | 3300042659 | Unclassified | 1670 |
| 231 | Ga0466711_202126 | 3300042615 | Bacteria | 1205 |
| 232 | Ga0466711_291180 | 3300042615 | Bacteria | 3191 |
| 233 | Ga0466726_096678 | 3300042619 | Bacteria | 11771 |
| 234 | Ga0466728_385140 | 3300042620 | Bacteria | 5829 |
| 235 | Ga0466703_046242 | 3300042636 | Bacteria | 15207 |
| 236 | Ga0466703_363230 | 3300042636 | Bacteria | 17265 |
| 237 | Ga0466704_284650 | 3300042643 | Bacteria | 5297 |
| 238 | Ga0466709_415545 | 3300042648 | Bacteria | 2665 |
| 239 | Ga0466708_042034 | 3300042652 | Bacteria | 19165 |
| 240 | Ga0466727_126471 | 3300042655 | Bacteria | 9058 |
| 241 | Ga0466656_157113 | 3300042550 | Bacteria | 1337 |
| 242 | Ga0466690_331263 | 3300042590 | Bacteria | 5394 |
| 243 | Ga0466706_108418 | 3300042599 | Unclassified | 1130 |
| 244 | Ga0466706_157831 | 3300042599 | Bacteria | 1933 |
| 245 | Ga0466713_006866 | 3300042602 | Bacteria | 27402 |
| 246 | Ga0466714_056569 | 3300042603 | Bacteria | 26688 |
| 247 | Ga0466714_085763 | 3300042603 | Bacteria | 5576 |
| 248 | Ga0466716_106744 | 3300042605 | Bacteria | 2335 |
| 249 | Ga0466719_150749 | 3300042606 | Bacteria | 8865 |
| 250 | Ga0466722_226975 | 3300042609 | Bacteria | 4822 |
| 251 | Ga0123353_10006412 | 3300010167 | Bacteria | 15656 |
| 252 | Ga0123353_10314324 | 3300010167 | Bacteria | 2381 |
| 253 | Ga0123354_10238045 | 3300010882 | Bacteria | 1881 |
| 254 | 2227619054 | 2225789004 | Bacteria | 45751 |
| 255 | JGI24696J40584_12961580 | 3300002834 | Bacteria | 22198 |
| 256 | Ga0072941_1021820 | 3300005201 | Bacteria | 5776 |
| 257 | Ga0072941_1052090 | 3300005201 | Bacteria | 2461 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF03116 | NQR2_RnfD_RnfE | NQR2, RnfD, RnfE family | 50 | 368 | 0.96 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.