Protein Family IF06019

Metagenome Isolate
174 Members
93 Samples
133 Scaffolds
303.53 Avg Length

🧬 Representative Sequence

ID
3300042602|Ga0466713_007360|Ga0466713_007360_2936_3943
Length
335 aa
Sequence
LDYSISIKKSSVELMIVTKKLGEKMTENNRLSVKLPGLDLKNPIIPASGCFGFGEEYAKYYDLNKLGSIMVKATTLHPRFGNPTPRVAETASGMLNAIGLQNPGLEVIMAEKLPWLNENFPDLPIIANVAGSEEDDYVAVCAKIGDAPNVKAIELNISCPNVKHGGQAFGTDPDVAAALVKACKAVSKVPLYVKLSPNVTDIVPIAKAVEHACADGLTMINTLMGVRFDLKTRKPVLANITGGLSGPAIKPVALKLIHQVAQVVDIPIIGMGGVESAQDVLEMYMAGASAVAVGTANFADPFVCPKIIEKLPEVMDQYGIDSLENLIQEVKNSKK

📊 Sample Types

Isolate 23.6%
Metagenome 76.4%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 26.4%
Termitidae 20.7%
Kalotermitidae 12.6%
Drosophilidae 6.9%
Tenebrionidae 6.9%
Blattidae 5.7%
Rhinotermitidae 3.4%
Termopsidae 3.4%
Passalidae 2.3%
Formicidae 2.3%
Scarabaeidae 1.1%
Apidae 1.1%
Acrididae 1.1%
Bombycidae 1.1%
Hodotermitidae 1.1%
Euphausiidae 1.1%
Curculionidae 1.1%
Elmidae 1.1%

🌳 Taxonomy

Archaea 0
Bacteria 164
Eukaryota 0
Viruses 0
Unclassified 10

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2825804107 Enterococcus durans BDGP3 Isolate Drosophilidae
2 2850695442 Lactococcus allomyrinae 1JSPR-7 Isolate Scarabaeidae
3 2855361764 Lysinibacillus fusiformis Juneja Isolate Drosophilidae
4 2905310146 Ligilactobacillus salivarius A3iob Isolate Apidae
5 2940202316 Parabacteroides sp. PF5-9 Isolate Blattidae
6 2820584674 Unclassified Firmicutes Emb289P1bin98 Isolate Unclassified
7 2035265001 Acrididae gut microbial communities from Texas A and M University, USA - Sample 321 Metagenome Acrididae
8 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
9 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
10 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
11 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
12 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
13 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
14 8018794549 Enterococcus sp. 6D12_DIV0197 6D12_DIV0197 Isolate
15 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
16 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
17 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
18 2852123468 Lysinibacillus sphaericus KCCM 35418 Isolate Unclassified
19 2940218408 Enterococcus sp. PF1-24 Isolate Blattidae
20 3300056814 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) Metagenome Tenebrionidae
21 3300056857 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) Metagenome Tenebrionidae
22 3300057007 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) Metagenome Tenebrionidae
23 8018754795 Enterococcus sp. 12F9_DIV0723 12F9_DIV0723 Isolate
24 8038268975 Enterococcus mundtii EM01 Isolate Bombycidae
25 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
26 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
27 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
28 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
29 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
30 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
31 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
32 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
33 8112490586 Staphylococcus muscae CCM 4175 Isolate
34 2900804455 Listeria sp. PSOL-1 Marseille-P4284 Isolate Unclassified
35 2917496769 Staphylococcus muscae DSM 7068 Isolate Unclassified
36 2940261461 Enterococcus sp. PFB1-1 Isolate Blattidae
37 2820474468 Unclassified Firmicutes Lab288P1bin84 Isolate Unclassified
38 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
39 8002519755 Planococcus sp. MSAK28401 Isolate Euphausiidae
40 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
41 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
42 3300002501 Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 Metagenome Termitidae
43 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
44 3300007767 Drosophila gut microbial communities from New York, USA - Drosophila suzukii male 6 gut Metagenome Drosophilidae
45 2878857142 Lactococcus lactis DmW198 Isolate Drosophilidae
46 2767802234 Cytobacillus kochii BDGP4 Isolate Drosophilidae
47 2820705605 Unclassified Firmicutes Co191P1bin34 Isolate Unclassified
48 2820549969 Unclassified Firmicutes Emb289P4bin66 Isolate Unclassified
49 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
50 8012112996 Staphylococcus muscae ATCC 49910 Isolate
51 8018750880 Enterococcus sp. 12E11_DIV0728 12E11_DIV0728 Isolate
52 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
53 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
54 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
55 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
56 2940373808 Fusobacterium sp. PH5-7 Isolate Blattidae
57 2524614537 Lysinibacillus sphaericus OT4b.31 Isolate Unclassified
58 2751185832 Lysinibacillus sp. AR18-8 Isolate Unclassified
59 2820240463 Unclassified Firmicutes Th196P3bin85 Isolate Unclassified
60 3300056790 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) Metagenome Tenebrionidae
61 3300056856 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) Metagenome Tenebrionidae
62 647533136 Enterococcus faecalis Fly1 Isolate Drosophilidae
63 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
64 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
65 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
66 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
67 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
68 3300003973 Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle Metagenome Curculionidae
69 2820236043 Unclassified Firmicutes Th196P3bin97 Isolate Unclassified
70 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
71 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae
72 8077780672 Enterococcus sp. PLM3 Isolate Formicidae
73 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
74 3300002932 Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 Metagenome Formicidae
75 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
76 2864816158 Priestia aryabhattai S00060 Isolate Elmidae
77 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
78 2775507073 Enterococcus sp. CR-Ec1 Isolate Unclassified
79 2820357977 Unclassified Firmicutes Nt197P3bin136 Isolate Unclassified
80 2820426531 Unclassified Firmicutes Lab288P3bin45 Isolate Unclassified
81 8064008355 Heyndrickxia oleronia Isolate Unclassified
82 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
83 2834951433 Brochothrix thermosphacta CD 337 Isolate Unclassified
84 2843246524 Lysinibacillus sphaericus DSM 28 Isolate Unclassified
85 2916858470 Heyndrickxia oleronia Isolate Unclassified
86 2940228231 Anaerovoracaceae bacterium PM5-7 Isolate Blattidae
87 2820312173 Unclassified Firmicutes Nt197P4bin8 Isolate Unclassified
88 2820429680 Unclassified Firmicutes Lab288P3bin30 Isolate Unclassified
89 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
90 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
91 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
92 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
93 3300005200 Nasutitermes gut metagenome Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0562378_0208 3300056814 Unclassified 139675
2 Ga0562378_0234 3300056814 Unclassified 130023
3 Ga0562375_0201 3300056856 Bacteria 169177
4 Ga0562376_1303 3300056857 Unclassified 35867
5 Ga0123355_10159935 3300009826 Bacteria 3396
6 Ga0123356_10007342 3300010049 Bacteria 10998
7 Ga0123356_10019519 3300010049 Bacteria 6425
8 Ga0123353_10131501 3300010167 Bacteria 4015
9 Ga0123353_10386598 3300010167 Bacteria 2090
10 Ga0123353_10738910 3300010167 Bacteria 1372
11 Ga0466718_064570 3300042617 Bacteria 17216
12 Ga0466718_097691 3300042617 Bacteria 1067
13 Ga0466728_123144 3300042620 Bacteria 23630
14 Ga0466729_187625 3300042621 Bacteria 4719
15 Ga0466721_242939 3300042608 Bacteria 1573
16 IMNBL1DRAFT_c0018037 3300000062 Bacteria 2947
17 Ga0105553_1039235 3300007767 Bacteria 6397
18 Ga0562379_0401 3300056790 Bacteria 96535
19 Ga0562377_0742 3300056842 Unclassified 45400
20 Ga0466696_278891 3300042596 Bacteria 171866
21 Ga0123355_10006806 3300009826 Bacteria 17003
22 Ga0123353_10000364 3300010167 Bacteria 55292
23 Ga0123353_10002335 3300010167 Bacteria 23556
24 Ga0123353_10077696 3300010167 Bacteria 5334
25 Ga0123353_10157597 3300010167 Bacteria 3617
26 Ga0123353_10636038 3300010167 Bacteria 1514
27 Ga0123353_10772166 3300010167 Bacteria 1333
28 Ga0466709_147127 3300042648 Bacteria 80266
29 Ga0072940_1317600 3300005200 Bacteria 6505
30 Ga0562379_0005 3300056790 Bacteria 2649770
31 Ga0562377_0010 3300056842 Bacteria 1401665
32 Ga0562375_0009 3300056856 Bacteria 1746158
33 Ga0562374_0006 3300057007 Bacteria 2178283
34 Ga0466690_140482 3300042590 Bacteria 2355
35 Ga0123356_10301957 3300010049 Bacteria 1706
36 Ga0123353_10000366 3300010167 Bacteria 55268
37 Ga0123353_10003759 3300010167 Bacteria 19319
38 Ga0466705_392085 3300042612 Bacteria 1643
39 Ga0466711_159981 3300042615 Bacteria 2368
40 Ga0466718_091324 3300042617 Bacteria 2117
41 Ga0466726_189882 3300042619 Bacteria 4433
42 Ga0466728_017755 3300042620 Bacteria 55878
43 Ga0466702_183068 3300042635 Bacteria 2376
44 Ga0466713_032560 3300042602 Bacteria 5019
45 Ga0466716_504370 3300042605 Bacteria 6237
46 Ga0466722_062168 3300042609 Bacteria 3243
47 Ga0063521_1001778 3300003973 Unclassified 5546
48 Ga0123355_10091507 3300009826 Bacteria 4822
49 Ga0123356_10039960 3300010049 Bacteria 4371
50 Ga0123353_10230193 3300010167 Bacteria 2890
51 Ga0123353_10297461 3300010167 Unclassified 2466
52 Ga0123353_10903535 3300010167 Bacteria 1202
53 Ga0466715_037900 3300042616 Bacteria 143938
54 Ga0466715_620245 3300042616 Bacteria 30740
55 Ga0466726_191097 3300042619 Bacteria 6806
56 Ga0466702_255010 3300042635 Bacteria 2272
57 Ga0466706_201404 3300042599 Unclassified 25454
58 JGI24703J35330_11748857 3300002501 Bacteria 56189
59 Ga0466733_151608 3300042659 Bacteria 7096
60 Ga0123357_10041458 3300009784 Unclassified 6259
61 Ga0123355_10136326 3300009826 Bacteria 3769
62 Ga0123356_10113368 3300010049 Bacteria 2623
63 Ga0123353_10000996 3300010167 Bacteria 34737
64 Ga0123353_10005512 3300010167 Bacteria 16631
65 Ga0123353_10373271 3300010167 Bacteria 2137
66 Ga0466710_258608 3300042613 Bacteria 1432
67 Ga0466723_022700 3300042618 Bacteria 21847
68 Ga0466703_403284 3300042636 Bacteria 2479
69 Ga0466709_041255 3300042648 Bacteria 64383
70 Ga0466706_193899 3300042599 Bacteria 1558
71 Ga0466707_278592 3300042601 Bacteria 154108
72 Ga0466713_007360 3300042602 Bacteria 27298
73 Ga0466714_064391 3300042603 Bacteria 1451
74 Ga0466716_005763 3300042605 Bacteria 8127
75 Ga0466716_216128 3300042605 Bacteria 23427
76 Ga0466722_016215 3300042609 Bacteria 10692
77 GhopperDRAF_NODE_354648_len_3032_cov_7_404354 2035265001 Bacteria 3062
78 2227480168 2225789004 Bacteria 98623
79 IMNBL1DRAFT_c0002631 3300000062 Bacteria 12299
80 JGI24702J35022_10044613 3300002462 Bacteria 2363
81 JGI24703J35330_11747475 3300002501 Bacteria 7010
82 CVPL010L_1001223 3300002932 Bacteria 8500
83 Ga0072940_1356567 3300005200 Bacteria 1337
84 Ga0466697_122719 3300042611 Bacteria 1496
85 Ga0562379_0078 3300056790 Bacteria 360595
86 Ga0123357_10339027 3300009784 Bacteria 1456
87 Ga0123355_10006048 3300009826 Bacteria 17839
88 Ga0123356_10279749 3300010049 Bacteria 1763
89 Ga0123353_10714272 3300010167 Bacteria 1403
90 Ga0466715_559916 3300042616 Unclassified 11129
91 Ga0466727_294305 3300042655 Bacteria 29904
92 Ga0466722_149034 3300042609 Bacteria 10550
93 JGI24702J35022_10008652 3300002462 Bacteria 5752
94 JGI24705J35276_12238076 3300002504 Bacteria 15638
95 Ga0562379_0455 3300056790 Bacteria 85147
96 Ga0562377_0231 3300056842 Bacteria 134767
97 Ga0562377_2700 3300056842 Unclassified 12157
98 Ga0123355_10039016 3300009826 Bacteria 7724
99 Ga0123353_10003277 3300010167 Bacteria 20423
100 Ga0123353_10013338 3300010167 Bacteria 11766
101 Ga0123353_10415236 3300010167 Bacteria 1996
102 Ga0123354_10377579 3300010882 Bacteria 1228
103 Ga0466705_506200 3300042612 Bacteria 14499
104 Ga0466726_221848 3300042619 Bacteria 5827
105 Ga0466729_114210 3300042621 Bacteria 7900
106 Ga0466731_124534 3300042622 Bacteria 1864
107 Ga0466703_125596 3300042636 Bacteria 3557
108 Ga0466704_026770 3300042643 Bacteria 49720
109 Ga0466706_138852 3300042599 Bacteria 93255
110 Ga0466713_054851 3300042602 Bacteria 53082
111 Ga0466713_156894 3300042602 Bacteria 10364
112 JGI24702J35022_10021564 3300002462 Bacteria 3492
113 JGI24696J40584_12955805 3300002834 Bacteria 2930
114 Ga0562377_1957 3300056842 Bacteria 17840
115 Ga0562375_0063 3300056856 Bacteria 420368
116 Ga0466692_116957 3300042591 Bacteria 13651
117 Ga0466692_169156 3300042591 Bacteria 59346
118 Ga0123356_10123803 3300010049 Bacteria 2521
119 Ga0123353_10152771 3300010167 Bacteria 3684
120 Ga0123353_10727670 3300010167 Bacteria 1386
121 Ga0466710_102939 3300042613 Bacteria 1351
122 Ga0466711_494909 3300042615 Bacteria 6784
123 Ga0466715_200707 3300042616 Bacteria 8411
124 Ga0466715_231009 3300042616 Bacteria 5488
125 Ga0466723_123543 3300042618 Bacteria 7786
126 Ga0466735_183521 3300042624 Bacteria 19245
127 Ga0466702_310712 3300042635 Bacteria 149509
128 Ga0466703_039914 3300042636 Bacteria 11018
129 Ga0466704_521846 3300042643 Bacteria 4789
130 Ga0466707_419478 3300042601 Bacteria 9061
131 Ga0466722_239809 3300042609 Bacteria 4245
132 Ga0068305_10256038 3300005083 Bacteria 8964
133 Ga0072941_1003221 3300005201 Bacteria 59208

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01180 DHO_dh Dihydroorotate dehydrogenase 31 315 0.99
PF03060 NMO Nitronate monooxygenase 241 296 0.9
PF00977 His_biosynth Histidine biosynthesis protein 250 324 0.87
PF01207 Dus Dihydrouridine synthase (Dus) 132 306 0.84

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF03060 GO:0018580 nitronate monooxygenase activity MF
PF00977 GO:0000105 L-histidine biosynthetic process BP

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.