Protein Family IF05957

Metagenome Metatranscriptome Isolate
240 Members
66 Samples
227 Scaffolds
88.71 Avg Length

🧬 Representative Sequence

ID
3300042601|Ga0466707_313882|Ga0466707_313882_746_1057
Length
103 aa
Sequence
MEKLYLDLFWGGDGEMTEKMVKVLNRAGVHARPAALVVQAIKDFKANIYIERGNEKINAKSIMGVITLGAAYGTELKIVAEGEDEQQAVDVLAHLFESRFEED

πŸ“Š Sample Types

Isolate 5.4%
Metagenome 94.2%
MAG 0.0%
Metatranscriptome 0.4%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Termitidae 47.6%
Unclassified 23.8%
Kalotermitidae 20.6%
Termopsidae 4.8%
Hodotermitidae 1.6%
Rhinotermitidae 1.6%

🌳 Taxonomy

Archaea 0
Bacteria 202
Eukaryota 0
Viruses 0
Unclassified 38

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 2030936001 Nasutitermes corniger hindgut microbial communities from Florida, USA Metagenome Termitidae
2 2781125660 Treponema sp. Emb289P3bin52 Isolate Unclassified
3 2781125696 Treponema sp. Th196P4bin22 Isolate Unclassified
4 2819992462 Unclassified Spirochaetes Nc150P4bin14 Isolate Unclassified
5 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
6 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
7 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
8 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
9 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
10 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
11 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
12 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
13 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
14 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
15 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
16 2781125656 Treponema sp. Emb289P1bin65 Isolate Unclassified
17 2781125663 Treponema sp. Emb289P3bin135 Isolate Unclassified
18 2781125665 Treponema sp. Emb289P3bin117 Isolate Unclassified
19 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
20 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
21 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
22 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
23 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
24 2781125659 Treponema sp. Emb289P3bin114 Isolate Unclassified
25 3300005485 Termite gut microbial communities from Costa Rica - P3 luminal contents Metagenome Termitidae
26 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
27 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
28 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
29 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
30 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
31 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
32 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
33 2781125657 Treponema sp. Emb289P3bin15 Isolate Unclassified
34 2781125697 Treponema sp. Th196P4bin17 Isolate Unclassified
35 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
36 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
37 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
38 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
39 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
40 2781125655 Treponema sp. Emb289P1bin105 Isolate Unclassified
41 2820020240 Unclassified Spirochaetes Nc150P3bin10 Isolate Unclassified
42 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
43 3300001880 Termite hindgut microbial communities from the Max Planck Institute, Bremen, Germany, analyzing fibers in the hindgut lumen - ASSEMBLED Fiber-Associated Metagenome Metagenome
44 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
45 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
46 3300022815 Termite gut microbial communities from Microcerotermes sp. nest - French Guiana - 27-16 mRNA Metatranscriptome Termitidae
47 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
48 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
49 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
50 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
51 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
52 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
53 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
54 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
55 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
56 3300002507 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 Metagenome Termitidae
57 2781125643 Treponema sp. Co191P3bin45 Isolate Unclassified
58 2781125664 Treponema sp. Emb289P3bin139 Isolate Unclassified
59 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
60 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
61 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
62 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
63 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
64 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
65 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
66 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_104098 3300042612 Bacteria 9560
2 Ga0466705_249916 3300042612 Bacteria 7236
3 Ga0466705_279577 3300042612 Bacteria 6850
4 Ga0466712_066534 3300042614 Bacteria 29891
5 Ga0466706_099011 3300042599 Bacteria 3551
6 Ga0466716_200199 3300042605 Bacteria 2253
7 Ga0466720_026420 3300042607 Bacteria 22729
8 Nasutiter_FTJKGMZ01BP914 2030936001 Unclassified 505
9 JGI24698J34947_10015087 3300002449 Bacteria 4208
10 JGI24698J34947_10023518 3300002449 Bacteria 3297
11 JGI24698J34947_10024894 3300002449 Bacteria 3190
12 JGI24698J34947_10032006 3300002449 Unclassified 2764
13 JGI24698J34947_10105896 3300002449 Unclassified 1252
14 JGI24698J34947_10295787 3300002449 Bacteria 586
15 JGI24695J34938_10011906 3300002450 Bacteria 4648
16 JGI24695J34938_10464780 3300002450 Bacteria 574
17 JGI24702J35022_10012096 3300002462 Bacteria 4803
18 JGI24697J35500_11271764 3300002507 Bacteria 4656
19 Ga0072940_1005639 3300005200 Bacteria 519
20 Ga0123357_10006128 3300009784 Bacteria 14575
21 Ga0123356_10199408 3300010049 Bacteria 2040
22 Ga0123356_12638798 3300010049 Bacteria 629
23 Ga0466703_244140 3300042636 Bacteria 1871
24 Ga0466708_002668 3300042652 Bacteria 9345
25 Ga0466727_051518 3300042655 Bacteria 1300
26 Ga0466694_103291 3300042594 Bacteria 6950
27 Ga0466712_186017 3300042614 Bacteria 1160
28 Ga0466712_246247 3300042614 Bacteria 21510
29 Ga0466715_246344 3300042616 Bacteria 2459
30 Ga0466718_010715 3300042617 Bacteria 1063
31 Ga0466706_019937 3300042599 Bacteria 1207
32 Ga0466720_044794 3300042607 Bacteria 11852
33 Ga0466720_126365 3300042607 Unclassified 3693
34 Ga0466720_153589 3300042607 Unclassified 1578
35 JGI24698J34947_10000381 3300002449 Bacteria 19961
36 JGI24698J34947_10007747 3300002449 Bacteria 5901
37 JGI24698J34947_10007829 3300002449 Bacteria 5869
38 JGI24698J34947_10030850 3300002449 Unclassified 2825
39 JGI24698J34947_10129326 3300002449 Bacteria 1082
40 JGI24702J35022_10005183 3300002462 Bacteria 7643
41 JGI24702J35022_10747403 3300002462 Bacteria 609
42 Ga0074263_129587 3300005485 Unclassified 846
43 Ga0123356_11365349 3300010049 Bacteria 870
44 Ga0123356_12118641 3300010049 Bacteria 702
45 Ga0466731_118426 3300042622 Bacteria 2942
46 Ga0466731_157031 3300042622 Bacteria 1167
47 Ga0466702_218355 3300042635 Bacteria 1012
48 Ga0466703_397587 3300042636 Bacteria 10760
49 Ga0466704_282860 3300042643 Bacteria 5889
50 Ga0466704_286001 3300042643 Bacteria 16185
51 Ga0466704_291113 3300042643 Bacteria 8199
52 Ga0264413_102453 3300024493 Unclassified 1408
53 Ga0466699_184149 3300042597 Bacteria 40447
54 Ga0466712_001781 3300042614 Unclassified 1223
55 Ga0466712_017843 3300042614 Bacteria 32238
56 Ga0466712_055057 3300042614 Bacteria 15370
57 Ga0466718_088546 3300042617 Bacteria 23804
58 Ga0466718_094572 3300042617 Unclassified 1158
59 Ga0466723_292080 3300042618 Unclassified 1179
60 Ga0466720_153172 3300042607 Unclassified 2671
61 JGI24702J35022_10011151 3300002462 Bacteria 5007
62 JGI24702J35022_10024385 3300002462 Bacteria 3269
63 JGI24696J40584_12415150 3300002834 Bacteria 561
64 Ga0072941_1028647 3300005201 Bacteria 6622
65 Ga0072941_1032982 3300005201 Bacteria 7979
66 Ga0074263_104710 3300005485 Bacteria 1574
67 Ga0123356_10001416 3300010049 Bacteria 26558
68 Ga0123356_10002450 3300010049 Bacteria 19828
69 Ga0123356_10310518 3300010049 Bacteria 1686
70 Ga0123356_13276082 3300010049 Bacteria 563
71 Ga0466731_088076 3300042622 Bacteria 1389
72 Ga0466702_131209 3300042635 Bacteria 2757
73 Ga0264413_107903 3300024493 Bacteria 3850
74 Ga0264413_111016 3300024493 Bacteria 5135
75 Ga0264413_121090 3300024493 Unclassified 2831
76 Ga0466690_215109 3300042590 Bacteria 18021
77 Ga0466696_011545 3300042596 Bacteria 1063
78 Ga0466712_117371 3300042614 Bacteria 5748
79 Ga0466712_243887 3300042614 Unclassified 4161
80 Ga0466711_205735 3300042615 Bacteria 9670
81 Ga0466715_404935 3300042616 Bacteria 9541
82 Ga0466718_029272 3300042617 Bacteria 5309
83 Ga0466723_319729 3300042618 Bacteria 3361
84 Ga0466726_090998 3300042619 Bacteria 1296
85 Ga0466701_093039 3300042598 Bacteria 1264
86 Ga0466707_195516 3300042601 Bacteria 1965
87 Ga0466707_313882 3300042601 Bacteria 2453
88 Ga0466720_002611 3300042607 Bacteria 14355
89 Ga0466720_061585 3300042607 Unclassified 5337
90 JGI24698J34947_10073647 3300002449 Bacteria 1629
91 JGI24695J34938_10003339 3300002450 Bacteria 11295
92 JGI24695J34938_10024585 3300002450 Bacteria 2891
93 Ga0123355_10000558 3300009826 Bacteria 49958
94 Ga0123356_10660371 3300010049 Bacteria 1213
95 Ga0123356_11023731 3300010049 Bacteria 996
96 Ga0123356_12686712 3300010049 Bacteria 623
97 Ga0123353_11110005 3300010167 Bacteria 1049
98 Ga0123354_10783680 3300010882 Bacteria 646
99 Ga0466731_012920 3300042622 Bacteria 154202
100 Ga0466735_077591 3300042624 Bacteria 6283
101 Ga0466735_194538 3300042624 Bacteria 15465
102 Ga0466702_173094 3300042635 Bacteria 1029
103 Ga0466703_028938 3300042636 Bacteria 11725
104 Ga0264413_118617 3300024493 Unclassified 2802
105 Ga0466733_043083 3300042659 Bacteria 1800
106 Ga0466712_237736 3300042614 Bacteria 8257
107 AustNasuHG_c1000051 3300000089 Bacteria 30422
108 JGI24698J34947_10136067 3300002449 Unclassified 1042
109 JGI24702J35022_10086781 3300002462 Bacteria 1699
110 JGI24702J35022_10514583 3300002462 Bacteria 735
111 Ga0072941_1005714 3300005201 Bacteria 22916
112 Ga0072941_1148448 3300005201 Bacteria 4889
113 Ga0123357_10062242 3300009784 Bacteria 4998
114 Ga0123356_10000072 3300010049 Bacteria 106738
115 Ga0123353_10729763 3300010167 Bacteria 1384
116 Ga0123353_10823370 3300010167 Bacteria 1277
117 Ga0123353_11824831 3300010167 Bacteria 754
118 Ga0466731_410531 3300042622 Bacteria 1219
119 Ga0466709_160299 3300042648 Bacteria 9974
120 Ga0466727_026021 3300042655 Bacteria 7776
121 Ga0415639_045661 3300038395 Bacteria 19047
122 Ga0466693_023256 3300042592 Bacteria 1926
123 Ga0466696_349637 3300042596 Bacteria 20040
124 Ga0466705_119878 3300042612 Bacteria 4236
125 Ga0466705_516274 3300042612 Bacteria 5456
126 Ga0466712_074362 3300042614 Unclassified 1933
127 Ga0466712_209501 3300042614 Unclassified 8636
128 Ga0466715_179127 3300042616 Bacteria 7264
129 Ga0466715_354615 3300042616 Bacteria 7771
130 Ga0466723_235034 3300042618 Bacteria 5275
131 Ga0466726_222925 3300042619 Bacteria 3313
132 Ga0466728_007132 3300042620 Bacteria 16135
133 Ga0466720_018767 3300042607 Unclassified 2021
134 Ga0466720_098244 3300042607 Bacteria 17951
135 Ga0466720_134034 3300042607 Unclassified 1326
136 AustNasuHG_c1005784 3300000089 Bacteria 4415
137 JGI24698J34947_10081233 3300002449 Unclassified 1520
138 Ga0072940_1032061 3300005200 Bacteria 4247
139 Ga0072941_1006120 3300005201 Bacteria 19777
140 Ga0072941_1014395 3300005201 Bacteria 8197
141 Ga0072941_1016940 3300005201 Unclassified 3117
142 Ga0123356_10000377 3300010049 Bacteria 50708
143 Ga0123356_10148628 3300010049 Bacteria 2322
144 Ga0123356_12055917 3300010049 Unclassified 713
145 Ga0123356_12355666 3300010049 Bacteria 666
146 Ga0123353_10009629 3300010167 Bacteria 13373
147 Ga0123353_10160990 3300010167 Bacteria 3573
148 Ga0123353_10293495 3300010167 Bacteria 2487
149 Ga0123353_10581817 3300010167 Bacteria 1606
150 Ga0466702_182481 3300042635 Bacteria 7195
151 Ga0466702_381878 3300042635 Bacteria 1438
152 Ga0466709_015726 3300042648 Bacteria 20991
153 Ga0255786_1027875 3300022815 Bacteria 1595
154 Ga0264413_104569 3300024493 Bacteria 16964
155 Ga0466690_110385 3300042590 Bacteria 2006
156 Ga0466690_184606 3300042590 Unclassified 2602
157 Ga0466691_081622 3300042593 Bacteria 1320
158 Ga0466705_066991 3300042612 Bacteria 6021
159 Ga0466733_020851 3300042659 Bacteria 1471
160 Ga0466712_001970 3300042614 Bacteria 12725
161 Ga0466712_127075 3300042614 Bacteria 33532
162 Ga0466723_298844 3300042618 Bacteria 2515
163 Ga0466700_325490 3300042600 Bacteria 1329
164 Ga0466707_212576 3300042601 Bacteria 1158
165 Ga0466713_120881 3300042602 Bacteria 8563
166 Ga0466720_139737 3300042607 Bacteria 1318
167 Ga0466720_160110 3300042607 Unclassified 10244
168 Ga0466720_217858 3300042607 Bacteria 11164
169 Ga0466722_190465 3300042609 Bacteria 1016
170 Ga0466698_024262 3300042610 Bacteria 1518
171 Ga0466698_244676 3300042610 Bacteria 1715
172 JGI24698J34947_10062394 3300002449 Unclassified 1830
173 JGI24695J34938_10000338 3300002450 Bacteria 46275
174 JGI24695J34938_10001456 3300002450 Bacteria 20021
175 JGI24695J34938_10049831 3300002450 Bacteria 1840
176 JGI24695J34938_10114138 3300002450 Unclassified 1100
177 Ga0074263_132322 3300005485 Unclassified 876
178 Ga0123356_10001548 3300010049 Bacteria 25312
179 Ga0123356_10010090 3300010049 Bacteria 9288
180 Ga0123356_10020775 3300010049 Bacteria 6209
181 Ga0123353_12192793 3300010167 Bacteria 669
182 Ga0123354_10247824 3300010882 Bacteria 1813
183 Ga0466731_124092 3300042622 Bacteria 2288
184 Ga0466702_199148 3300042635 Bacteria 23344
185 Ga0466702_222629 3300042635 Bacteria 24290
186 Ga0466702_356122 3300042635 Bacteria 5924
187 Ga0466703_335383 3300042636 Bacteria 27062
188 Ga0466708_105723 3300042652 Bacteria 3275
189 Ga0466727_141755 3300042655 Bacteria 1159
190 Ga0466727_282948 3300042655 Bacteria 2033
191 Ga0264413_133142 3300024493 Unclassified 3599
192 Ga0415639_003277 3300038395 Bacteria 2637
193 Ga0466694_127307 3300042594 Bacteria 3304
194 Ga0466694_373892 3300042594 Bacteria 1963
195 Ga0466694_374812 3300042594 Bacteria 8591
196 Ga0466696_067956 3300042596 Bacteria 1536
197 Ga0466699_142839 3300042597 Bacteria 8935
198 Ga0466699_169800 3300042597 Bacteria 16672
199 Ga0466705_056122 3300042612 Bacteria 8245
200 Ga0466705_076288 3300042612 Bacteria 26554
201 Ga0466732_275057 3300042656 Unclassified 14798
202 Ga0466732_403599 3300042656 Bacteria 5911
203 Ga0466712_035616 3300042614 Unclassified 5718
204 Ga0466715_299868 3300042616 Bacteria 2027
205 Ga0466715_410525 3300042616 Bacteria 16035
206 Ga0466715_566166 3300042616 Bacteria 1781
207 Ga0466718_026435 3300042617 Bacteria 5404
208 Ga0466718_027021 3300042617 Bacteria 7916
209 Ga0466718_126227 3300042617 Unclassified 1634
210 Ga0466720_029282 3300042607 Bacteria 22130
211 AustNasuHG_c1000966 3300000089 Bacteria 10361
212 FAAS_10496035 3300001880 Bacteria 537
213 FAAS_10676637 3300001880 Unclassified 528
214 JGI24698J34947_10000069 3300002449 Bacteria 32733
215 JGI24695J34938_10000181 3300002450 Bacteria 58662
216 JGI24699J35502_10595936 3300002509 Unclassified 679
217 Ga0072941_1020706 3300005201 Bacteria 12575
218 Ga0072941_1074918 3300005201 Bacteria 3310
219 Ga0074263_114765 3300005485 Unclassified 1733
220 Ga0074263_120742 3300005485 Unclassified 607
221 Ga0123355_10058894 3300009826 Bacteria 6211
222 Ga0123356_10001341 3300010049 Bacteria 27214
223 Ga0123356_13247123 3300010049 Bacteria 566
224 Ga0466708_455790 3300042652 Bacteria 4721
225 Ga0264413_108138 3300024493 Unclassified 5155
226 Ga0466691_069642 3300042593 Bacteria 11453
227 Ga0466694_186896 3300042594 Bacteria 25247

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00381 PTS-HPr PTS HPr component phosphorylation site 18 97 0.97

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.