Protein Family IF05957
Metagenome
Metatranscriptome
Isolate
240
Members
66
Samples
227
Scaffolds
88.71
Avg Length
Representative Sequence
- ID
- 3300042601|Ga0466707_313882|Ga0466707_313882_746_1057
- Length
- 103 aa
- Sequence
- MEKLYLDLFWGGDGEMTEKMVKVLNRAGVHARPAALVVQAIKDFKANIYIERGNEKINAKSIMGVITLGAAYGTELKIVAEGEDEQQAVDVLAHLFESRFEED
Sample Types
Isolate
5.4%
Metagenome
94.2%
MAG
0.0%
Metatranscriptome
0.4%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
47.6%
Unclassified
23.8%
Kalotermitidae
20.6%
Termopsidae
4.8%
Hodotermitidae
1.6%
Rhinotermitidae
1.6%
Taxonomy
Archaea
0
Bacteria
202
Eukaryota
0
Viruses
0
Unclassified
38
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2030936001 | Nasutitermes corniger hindgut microbial communities from Florida, USA | Metagenome | Termitidae |
| 2 | 2781125660 | Treponema sp. Emb289P3bin52 | Isolate | Unclassified |
| 3 | 2781125696 | Treponema sp. Th196P4bin22 | Isolate | Unclassified |
| 4 | 2819992462 | Unclassified Spirochaetes Nc150P4bin14 | Isolate | Unclassified |
| 5 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 6 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 7 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 8 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 9 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 10 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 11 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 12 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 13 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 14 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 15 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 16 | 2781125656 | Treponema sp. Emb289P1bin65 | Isolate | Unclassified |
| 17 | 2781125663 | Treponema sp. Emb289P3bin135 | Isolate | Unclassified |
| 18 | 2781125665 | Treponema sp. Emb289P3bin117 | Isolate | Unclassified |
| 19 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 20 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 21 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 22 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 23 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 24 | 2781125659 | Treponema sp. Emb289P3bin114 | Isolate | Unclassified |
| 25 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 26 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 27 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 28 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 29 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 30 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 31 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 32 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 33 | 2781125657 | Treponema sp. Emb289P3bin15 | Isolate | Unclassified |
| 34 | 2781125697 | Treponema sp. Th196P4bin17 | Isolate | Unclassified |
| 35 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 36 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 37 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 38 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 39 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 40 | 2781125655 | Treponema sp. Emb289P1bin105 | Isolate | Unclassified |
| 41 | 2820020240 | Unclassified Spirochaetes Nc150P3bin10 | Isolate | Unclassified |
| 42 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 43 | 3300001880 | Termite hindgut microbial communities from the Max Planck Institute, Bremen, Germany, analyzing fibers in the hindgut lumen - ASSEMBLED Fiber-Associated Metagenome | Metagenome | |
| 44 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 45 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 46 | 3300022815 | Termite gut microbial communities from Microcerotermes sp. nest - French Guiana - 27-16 mRNA | Metatranscriptome | Termitidae |
| 47 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 48 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 49 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 50 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 51 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 52 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 53 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 54 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 55 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 56 | 3300002507 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 | Metagenome | Termitidae |
| 57 | 2781125643 | Treponema sp. Co191P3bin45 | Isolate | Unclassified |
| 58 | 2781125664 | Treponema sp. Emb289P3bin139 | Isolate | Unclassified |
| 59 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 60 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 61 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 62 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 63 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 64 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 65 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 66 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_104098 | 3300042612 | Bacteria | 9560 |
| 2 | Ga0466705_249916 | 3300042612 | Bacteria | 7236 |
| 3 | Ga0466705_279577 | 3300042612 | Bacteria | 6850 |
| 4 | Ga0466712_066534 | 3300042614 | Bacteria | 29891 |
| 5 | Ga0466706_099011 | 3300042599 | Bacteria | 3551 |
| 6 | Ga0466716_200199 | 3300042605 | Bacteria | 2253 |
| 7 | Ga0466720_026420 | 3300042607 | Bacteria | 22729 |
| 8 | Nasutiter_FTJKGMZ01BP914 | 2030936001 | Unclassified | 505 |
| 9 | JGI24698J34947_10015087 | 3300002449 | Bacteria | 4208 |
| 10 | JGI24698J34947_10023518 | 3300002449 | Bacteria | 3297 |
| 11 | JGI24698J34947_10024894 | 3300002449 | Bacteria | 3190 |
| 12 | JGI24698J34947_10032006 | 3300002449 | Unclassified | 2764 |
| 13 | JGI24698J34947_10105896 | 3300002449 | Unclassified | 1252 |
| 14 | JGI24698J34947_10295787 | 3300002449 | Bacteria | 586 |
| 15 | JGI24695J34938_10011906 | 3300002450 | Bacteria | 4648 |
| 16 | JGI24695J34938_10464780 | 3300002450 | Bacteria | 574 |
| 17 | JGI24702J35022_10012096 | 3300002462 | Bacteria | 4803 |
| 18 | JGI24697J35500_11271764 | 3300002507 | Bacteria | 4656 |
| 19 | Ga0072940_1005639 | 3300005200 | Bacteria | 519 |
| 20 | Ga0123357_10006128 | 3300009784 | Bacteria | 14575 |
| 21 | Ga0123356_10199408 | 3300010049 | Bacteria | 2040 |
| 22 | Ga0123356_12638798 | 3300010049 | Bacteria | 629 |
| 23 | Ga0466703_244140 | 3300042636 | Bacteria | 1871 |
| 24 | Ga0466708_002668 | 3300042652 | Bacteria | 9345 |
| 25 | Ga0466727_051518 | 3300042655 | Bacteria | 1300 |
| 26 | Ga0466694_103291 | 3300042594 | Bacteria | 6950 |
| 27 | Ga0466712_186017 | 3300042614 | Bacteria | 1160 |
| 28 | Ga0466712_246247 | 3300042614 | Bacteria | 21510 |
| 29 | Ga0466715_246344 | 3300042616 | Bacteria | 2459 |
| 30 | Ga0466718_010715 | 3300042617 | Bacteria | 1063 |
| 31 | Ga0466706_019937 | 3300042599 | Bacteria | 1207 |
| 32 | Ga0466720_044794 | 3300042607 | Bacteria | 11852 |
| 33 | Ga0466720_126365 | 3300042607 | Unclassified | 3693 |
| 34 | Ga0466720_153589 | 3300042607 | Unclassified | 1578 |
| 35 | JGI24698J34947_10000381 | 3300002449 | Bacteria | 19961 |
| 36 | JGI24698J34947_10007747 | 3300002449 | Bacteria | 5901 |
| 37 | JGI24698J34947_10007829 | 3300002449 | Bacteria | 5869 |
| 38 | JGI24698J34947_10030850 | 3300002449 | Unclassified | 2825 |
| 39 | JGI24698J34947_10129326 | 3300002449 | Bacteria | 1082 |
| 40 | JGI24702J35022_10005183 | 3300002462 | Bacteria | 7643 |
| 41 | JGI24702J35022_10747403 | 3300002462 | Bacteria | 609 |
| 42 | Ga0074263_129587 | 3300005485 | Unclassified | 846 |
| 43 | Ga0123356_11365349 | 3300010049 | Bacteria | 870 |
| 44 | Ga0123356_12118641 | 3300010049 | Bacteria | 702 |
| 45 | Ga0466731_118426 | 3300042622 | Bacteria | 2942 |
| 46 | Ga0466731_157031 | 3300042622 | Bacteria | 1167 |
| 47 | Ga0466702_218355 | 3300042635 | Bacteria | 1012 |
| 48 | Ga0466703_397587 | 3300042636 | Bacteria | 10760 |
| 49 | Ga0466704_282860 | 3300042643 | Bacteria | 5889 |
| 50 | Ga0466704_286001 | 3300042643 | Bacteria | 16185 |
| 51 | Ga0466704_291113 | 3300042643 | Bacteria | 8199 |
| 52 | Ga0264413_102453 | 3300024493 | Unclassified | 1408 |
| 53 | Ga0466699_184149 | 3300042597 | Bacteria | 40447 |
| 54 | Ga0466712_001781 | 3300042614 | Unclassified | 1223 |
| 55 | Ga0466712_017843 | 3300042614 | Bacteria | 32238 |
| 56 | Ga0466712_055057 | 3300042614 | Bacteria | 15370 |
| 57 | Ga0466718_088546 | 3300042617 | Bacteria | 23804 |
| 58 | Ga0466718_094572 | 3300042617 | Unclassified | 1158 |
| 59 | Ga0466723_292080 | 3300042618 | Unclassified | 1179 |
| 60 | Ga0466720_153172 | 3300042607 | Unclassified | 2671 |
| 61 | JGI24702J35022_10011151 | 3300002462 | Bacteria | 5007 |
| 62 | JGI24702J35022_10024385 | 3300002462 | Bacteria | 3269 |
| 63 | JGI24696J40584_12415150 | 3300002834 | Bacteria | 561 |
| 64 | Ga0072941_1028647 | 3300005201 | Bacteria | 6622 |
| 65 | Ga0072941_1032982 | 3300005201 | Bacteria | 7979 |
| 66 | Ga0074263_104710 | 3300005485 | Bacteria | 1574 |
| 67 | Ga0123356_10001416 | 3300010049 | Bacteria | 26558 |
| 68 | Ga0123356_10002450 | 3300010049 | Bacteria | 19828 |
| 69 | Ga0123356_10310518 | 3300010049 | Bacteria | 1686 |
| 70 | Ga0123356_13276082 | 3300010049 | Bacteria | 563 |
| 71 | Ga0466731_088076 | 3300042622 | Bacteria | 1389 |
| 72 | Ga0466702_131209 | 3300042635 | Bacteria | 2757 |
| 73 | Ga0264413_107903 | 3300024493 | Bacteria | 3850 |
| 74 | Ga0264413_111016 | 3300024493 | Bacteria | 5135 |
| 75 | Ga0264413_121090 | 3300024493 | Unclassified | 2831 |
| 76 | Ga0466690_215109 | 3300042590 | Bacteria | 18021 |
| 77 | Ga0466696_011545 | 3300042596 | Bacteria | 1063 |
| 78 | Ga0466712_117371 | 3300042614 | Bacteria | 5748 |
| 79 | Ga0466712_243887 | 3300042614 | Unclassified | 4161 |
| 80 | Ga0466711_205735 | 3300042615 | Bacteria | 9670 |
| 81 | Ga0466715_404935 | 3300042616 | Bacteria | 9541 |
| 82 | Ga0466718_029272 | 3300042617 | Bacteria | 5309 |
| 83 | Ga0466723_319729 | 3300042618 | Bacteria | 3361 |
| 84 | Ga0466726_090998 | 3300042619 | Bacteria | 1296 |
| 85 | Ga0466701_093039 | 3300042598 | Bacteria | 1264 |
| 86 | Ga0466707_195516 | 3300042601 | Bacteria | 1965 |
| 87 | Ga0466707_313882 | 3300042601 | Bacteria | 2453 |
| 88 | Ga0466720_002611 | 3300042607 | Bacteria | 14355 |
| 89 | Ga0466720_061585 | 3300042607 | Unclassified | 5337 |
| 90 | JGI24698J34947_10073647 | 3300002449 | Bacteria | 1629 |
| 91 | JGI24695J34938_10003339 | 3300002450 | Bacteria | 11295 |
| 92 | JGI24695J34938_10024585 | 3300002450 | Bacteria | 2891 |
| 93 | Ga0123355_10000558 | 3300009826 | Bacteria | 49958 |
| 94 | Ga0123356_10660371 | 3300010049 | Bacteria | 1213 |
| 95 | Ga0123356_11023731 | 3300010049 | Bacteria | 996 |
| 96 | Ga0123356_12686712 | 3300010049 | Bacteria | 623 |
| 97 | Ga0123353_11110005 | 3300010167 | Bacteria | 1049 |
| 98 | Ga0123354_10783680 | 3300010882 | Bacteria | 646 |
| 99 | Ga0466731_012920 | 3300042622 | Bacteria | 154202 |
| 100 | Ga0466735_077591 | 3300042624 | Bacteria | 6283 |
| 101 | Ga0466735_194538 | 3300042624 | Bacteria | 15465 |
| 102 | Ga0466702_173094 | 3300042635 | Bacteria | 1029 |
| 103 | Ga0466703_028938 | 3300042636 | Bacteria | 11725 |
| 104 | Ga0264413_118617 | 3300024493 | Unclassified | 2802 |
| 105 | Ga0466733_043083 | 3300042659 | Bacteria | 1800 |
| 106 | Ga0466712_237736 | 3300042614 | Bacteria | 8257 |
| 107 | AustNasuHG_c1000051 | 3300000089 | Bacteria | 30422 |
| 108 | JGI24698J34947_10136067 | 3300002449 | Unclassified | 1042 |
| 109 | JGI24702J35022_10086781 | 3300002462 | Bacteria | 1699 |
| 110 | JGI24702J35022_10514583 | 3300002462 | Bacteria | 735 |
| 111 | Ga0072941_1005714 | 3300005201 | Bacteria | 22916 |
| 112 | Ga0072941_1148448 | 3300005201 | Bacteria | 4889 |
| 113 | Ga0123357_10062242 | 3300009784 | Bacteria | 4998 |
| 114 | Ga0123356_10000072 | 3300010049 | Bacteria | 106738 |
| 115 | Ga0123353_10729763 | 3300010167 | Bacteria | 1384 |
| 116 | Ga0123353_10823370 | 3300010167 | Bacteria | 1277 |
| 117 | Ga0123353_11824831 | 3300010167 | Bacteria | 754 |
| 118 | Ga0466731_410531 | 3300042622 | Bacteria | 1219 |
| 119 | Ga0466709_160299 | 3300042648 | Bacteria | 9974 |
| 120 | Ga0466727_026021 | 3300042655 | Bacteria | 7776 |
| 121 | Ga0415639_045661 | 3300038395 | Bacteria | 19047 |
| 122 | Ga0466693_023256 | 3300042592 | Bacteria | 1926 |
| 123 | Ga0466696_349637 | 3300042596 | Bacteria | 20040 |
| 124 | Ga0466705_119878 | 3300042612 | Bacteria | 4236 |
| 125 | Ga0466705_516274 | 3300042612 | Bacteria | 5456 |
| 126 | Ga0466712_074362 | 3300042614 | Unclassified | 1933 |
| 127 | Ga0466712_209501 | 3300042614 | Unclassified | 8636 |
| 128 | Ga0466715_179127 | 3300042616 | Bacteria | 7264 |
| 129 | Ga0466715_354615 | 3300042616 | Bacteria | 7771 |
| 130 | Ga0466723_235034 | 3300042618 | Bacteria | 5275 |
| 131 | Ga0466726_222925 | 3300042619 | Bacteria | 3313 |
| 132 | Ga0466728_007132 | 3300042620 | Bacteria | 16135 |
| 133 | Ga0466720_018767 | 3300042607 | Unclassified | 2021 |
| 134 | Ga0466720_098244 | 3300042607 | Bacteria | 17951 |
| 135 | Ga0466720_134034 | 3300042607 | Unclassified | 1326 |
| 136 | AustNasuHG_c1005784 | 3300000089 | Bacteria | 4415 |
| 137 | JGI24698J34947_10081233 | 3300002449 | Unclassified | 1520 |
| 138 | Ga0072940_1032061 | 3300005200 | Bacteria | 4247 |
| 139 | Ga0072941_1006120 | 3300005201 | Bacteria | 19777 |
| 140 | Ga0072941_1014395 | 3300005201 | Bacteria | 8197 |
| 141 | Ga0072941_1016940 | 3300005201 | Unclassified | 3117 |
| 142 | Ga0123356_10000377 | 3300010049 | Bacteria | 50708 |
| 143 | Ga0123356_10148628 | 3300010049 | Bacteria | 2322 |
| 144 | Ga0123356_12055917 | 3300010049 | Unclassified | 713 |
| 145 | Ga0123356_12355666 | 3300010049 | Bacteria | 666 |
| 146 | Ga0123353_10009629 | 3300010167 | Bacteria | 13373 |
| 147 | Ga0123353_10160990 | 3300010167 | Bacteria | 3573 |
| 148 | Ga0123353_10293495 | 3300010167 | Bacteria | 2487 |
| 149 | Ga0123353_10581817 | 3300010167 | Bacteria | 1606 |
| 150 | Ga0466702_182481 | 3300042635 | Bacteria | 7195 |
| 151 | Ga0466702_381878 | 3300042635 | Bacteria | 1438 |
| 152 | Ga0466709_015726 | 3300042648 | Bacteria | 20991 |
| 153 | Ga0255786_1027875 | 3300022815 | Bacteria | 1595 |
| 154 | Ga0264413_104569 | 3300024493 | Bacteria | 16964 |
| 155 | Ga0466690_110385 | 3300042590 | Bacteria | 2006 |
| 156 | Ga0466690_184606 | 3300042590 | Unclassified | 2602 |
| 157 | Ga0466691_081622 | 3300042593 | Bacteria | 1320 |
| 158 | Ga0466705_066991 | 3300042612 | Bacteria | 6021 |
| 159 | Ga0466733_020851 | 3300042659 | Bacteria | 1471 |
| 160 | Ga0466712_001970 | 3300042614 | Bacteria | 12725 |
| 161 | Ga0466712_127075 | 3300042614 | Bacteria | 33532 |
| 162 | Ga0466723_298844 | 3300042618 | Bacteria | 2515 |
| 163 | Ga0466700_325490 | 3300042600 | Bacteria | 1329 |
| 164 | Ga0466707_212576 | 3300042601 | Bacteria | 1158 |
| 165 | Ga0466713_120881 | 3300042602 | Bacteria | 8563 |
| 166 | Ga0466720_139737 | 3300042607 | Bacteria | 1318 |
| 167 | Ga0466720_160110 | 3300042607 | Unclassified | 10244 |
| 168 | Ga0466720_217858 | 3300042607 | Bacteria | 11164 |
| 169 | Ga0466722_190465 | 3300042609 | Bacteria | 1016 |
| 170 | Ga0466698_024262 | 3300042610 | Bacteria | 1518 |
| 171 | Ga0466698_244676 | 3300042610 | Bacteria | 1715 |
| 172 | JGI24698J34947_10062394 | 3300002449 | Unclassified | 1830 |
| 173 | JGI24695J34938_10000338 | 3300002450 | Bacteria | 46275 |
| 174 | JGI24695J34938_10001456 | 3300002450 | Bacteria | 20021 |
| 175 | JGI24695J34938_10049831 | 3300002450 | Bacteria | 1840 |
| 176 | JGI24695J34938_10114138 | 3300002450 | Unclassified | 1100 |
| 177 | Ga0074263_132322 | 3300005485 | Unclassified | 876 |
| 178 | Ga0123356_10001548 | 3300010049 | Bacteria | 25312 |
| 179 | Ga0123356_10010090 | 3300010049 | Bacteria | 9288 |
| 180 | Ga0123356_10020775 | 3300010049 | Bacteria | 6209 |
| 181 | Ga0123353_12192793 | 3300010167 | Bacteria | 669 |
| 182 | Ga0123354_10247824 | 3300010882 | Bacteria | 1813 |
| 183 | Ga0466731_124092 | 3300042622 | Bacteria | 2288 |
| 184 | Ga0466702_199148 | 3300042635 | Bacteria | 23344 |
| 185 | Ga0466702_222629 | 3300042635 | Bacteria | 24290 |
| 186 | Ga0466702_356122 | 3300042635 | Bacteria | 5924 |
| 187 | Ga0466703_335383 | 3300042636 | Bacteria | 27062 |
| 188 | Ga0466708_105723 | 3300042652 | Bacteria | 3275 |
| 189 | Ga0466727_141755 | 3300042655 | Bacteria | 1159 |
| 190 | Ga0466727_282948 | 3300042655 | Bacteria | 2033 |
| 191 | Ga0264413_133142 | 3300024493 | Unclassified | 3599 |
| 192 | Ga0415639_003277 | 3300038395 | Bacteria | 2637 |
| 193 | Ga0466694_127307 | 3300042594 | Bacteria | 3304 |
| 194 | Ga0466694_373892 | 3300042594 | Bacteria | 1963 |
| 195 | Ga0466694_374812 | 3300042594 | Bacteria | 8591 |
| 196 | Ga0466696_067956 | 3300042596 | Bacteria | 1536 |
| 197 | Ga0466699_142839 | 3300042597 | Bacteria | 8935 |
| 198 | Ga0466699_169800 | 3300042597 | Bacteria | 16672 |
| 199 | Ga0466705_056122 | 3300042612 | Bacteria | 8245 |
| 200 | Ga0466705_076288 | 3300042612 | Bacteria | 26554 |
| 201 | Ga0466732_275057 | 3300042656 | Unclassified | 14798 |
| 202 | Ga0466732_403599 | 3300042656 | Bacteria | 5911 |
| 203 | Ga0466712_035616 | 3300042614 | Unclassified | 5718 |
| 204 | Ga0466715_299868 | 3300042616 | Bacteria | 2027 |
| 205 | Ga0466715_410525 | 3300042616 | Bacteria | 16035 |
| 206 | Ga0466715_566166 | 3300042616 | Bacteria | 1781 |
| 207 | Ga0466718_026435 | 3300042617 | Bacteria | 5404 |
| 208 | Ga0466718_027021 | 3300042617 | Bacteria | 7916 |
| 209 | Ga0466718_126227 | 3300042617 | Unclassified | 1634 |
| 210 | Ga0466720_029282 | 3300042607 | Bacteria | 22130 |
| 211 | AustNasuHG_c1000966 | 3300000089 | Bacteria | 10361 |
| 212 | FAAS_10496035 | 3300001880 | Bacteria | 537 |
| 213 | FAAS_10676637 | 3300001880 | Unclassified | 528 |
| 214 | JGI24698J34947_10000069 | 3300002449 | Bacteria | 32733 |
| 215 | JGI24695J34938_10000181 | 3300002450 | Bacteria | 58662 |
| 216 | JGI24699J35502_10595936 | 3300002509 | Unclassified | 679 |
| 217 | Ga0072941_1020706 | 3300005201 | Bacteria | 12575 |
| 218 | Ga0072941_1074918 | 3300005201 | Bacteria | 3310 |
| 219 | Ga0074263_114765 | 3300005485 | Unclassified | 1733 |
| 220 | Ga0074263_120742 | 3300005485 | Unclassified | 607 |
| 221 | Ga0123355_10058894 | 3300009826 | Bacteria | 6211 |
| 222 | Ga0123356_10001341 | 3300010049 | Bacteria | 27214 |
| 223 | Ga0123356_13247123 | 3300010049 | Bacteria | 566 |
| 224 | Ga0466708_455790 | 3300042652 | Bacteria | 4721 |
| 225 | Ga0264413_108138 | 3300024493 | Unclassified | 5155 |
| 226 | Ga0466691_069642 | 3300042593 | Bacteria | 11453 |
| 227 | Ga0466694_186896 | 3300042594 | Bacteria | 25247 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00381 | PTS-HPr | PTS HPr component phosphorylation site | 18 | 97 | 0.97 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.