Protein Family IF05926
Metagenome
Isolate
177
Members
55
Samples
173
Scaffolds
114.92
Avg Length
Representative Sequence
- ID
- 3300042601|Ga0466707_259768|Ga0466707_259768_1603_1998
- Length
- 131 aa
- Sequence
- VENNDKNYKTNYKIMDSTRLQKIERLIQKDLGEIFLLQAKQMPGVLVSVTRVRMSPDLSVSKAYLSIFPTERGKEILDNINSNKKSVRYELGLRIGKQVRRIPELIFFLDDSIDYLENIDHLLNQDKEKEH
Sample Types
Isolate
2.3%
Metagenome
97.7%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
35.2%
Kalotermitidae
20.4%
Unclassified
11.1%
Passalidae
7.4%
Armadillidiidae
7.4%
Termopsidae
7.4%
Rhinotermitidae
5.6%
Culicidae
1.9%
Hodotermitidae
1.9%
Daphniidae
1.9%
Taxonomy
Archaea
0
Bacteria
163
Eukaryota
0
Viruses
0
Unclassified
14
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820762746 | Unclassified Bacteroidetes Mp193P4bin3 | Isolate | Unclassified |
| 2 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 3 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 4 | 3300012832 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E6 MG | Metagenome | Culicidae |
| 5 | 3300012858 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG | Metagenome | Armadillidiidae |
| 6 | 2225789003 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) | Metagenome | Passalidae |
| 7 | 643348524 | Candidatus Azobacteroides pseudotrichonymphae gv. CFP2 | Isolate | Unclassified |
| 8 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 9 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 10 | 3300012841 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E1 MG | Metagenome | Armadillidiidae |
| 11 | 3300012847 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG | Metagenome | Armadillidiidae |
| 12 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 13 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 14 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 15 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 16 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 17 | 3300000036 | Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) | Metagenome | Passalidae |
| 18 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 19 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 20 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 21 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 22 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 23 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 24 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 25 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 26 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 27 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 28 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 29 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 30 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 31 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 32 | 2967483437 | Candidatus Ordinivivax streblomastigis St1 | Isolate | Unclassified |
| 33 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 34 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 35 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 36 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 37 | 2590828803 | Pedobacter glucosidilyticus DD6b | Isolate | Daphniidae |
| 38 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 39 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 40 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 41 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 42 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 43 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 44 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 45 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 46 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 47 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 48 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 49 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 50 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 51 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 52 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 53 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 54 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 55 | 3300012848 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG | Metagenome | Armadillidiidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466697_181881 | 3300042611 | Bacteria | 1197 |
| 2 | Ga0466731_261871 | 3300042622 | Bacteria | 1429 |
| 3 | Ga0466735_145232 | 3300042624 | Bacteria | 1194 |
| 4 | Ga0466703_313230 | 3300042636 | Bacteria | 4151 |
| 5 | Ga0466703_337432 | 3300042636 | Bacteria | 3145 |
| 6 | Ga0123357_10022903 | 3300009784 | Bacteria | 8382 |
| 7 | Ga0123356_10013360 | 3300010049 | Bacteria | 7930 |
| 8 | Ga0466715_514467 | 3300042616 | Bacteria | 4325 |
| 9 | Ga0160458_100057 | 3300012832 | Bacteria | 146622 |
| 10 | Ga0466696_452820 | 3300042596 | Bacteria | 3624 |
| 11 | Ga0466713_033285 | 3300042602 | Bacteria | 17867 |
| 12 | Ga0466717_243920 | 3300042604 | Bacteria | 1386 |
| 13 | Ga0466719_106322 | 3300042606 | Bacteria | 7666 |
| 14 | IMNBL1DRAFT_c0007325 | 3300000062 | Bacteria | 5832 |
| 15 | JGI24702J35022_10013454 | 3300002462 | Bacteria | 4533 |
| 16 | JGI24696J40584_12435046 | 3300002834 | Bacteria | 569 |
| 17 | Ga0068302_10745700 | 3300005071 | Unclassified | 1064 |
| 18 | Ga0068305_10048561 | 3300005083 | Unclassified | 4010 |
| 19 | Ga0068305_10323311 | 3300005083 | Unclassified | 2370 |
| 20 | Ga0466735_168414 | 3300042624 | Bacteria | 5825 |
| 21 | Ga0466703_116550 | 3300042636 | Bacteria | 7069 |
| 22 | Ga0466727_184423 | 3300042655 | Bacteria | 96228 |
| 23 | Ga0123357_10357539 | 3300009784 | Bacteria | 1387 |
| 24 | Ga0123356_10461165 | 3300010049 | Bacteria | 1420 |
| 25 | Ga0123353_11308998 | 3300010167 | Bacteria | 940 |
| 26 | Ga0123354_10008474 | 3300010882 | Bacteria | 15635 |
| 27 | Ga0123354_10053793 | 3300010882 | Bacteria | 6050 |
| 28 | Ga0123354_10288361 | 3300010882 | Bacteria | 1578 |
| 29 | Ga0466692_188827 | 3300042591 | Bacteria | 9696 |
| 30 | Ga0466691_184535 | 3300042593 | Bacteria | 1202 |
| 31 | Ga0466706_221770 | 3300042599 | Bacteria | 1636 |
| 32 | Ga0466700_391349 | 3300042600 | Bacteria | 41227 |
| 33 | Ga0466717_277027 | 3300042604 | Bacteria | 1883 |
| 34 | Ga0466716_240490 | 3300042605 | Bacteria | 4881 |
| 35 | Ga0466705_092651 | 3300042612 | Bacteria | 4050 |
| 36 | Ga0466735_090702 | 3300042624 | Bacteria | 4512 |
| 37 | Ga0466704_470753 | 3300042643 | Bacteria | 5076 |
| 38 | Ga0123357_10006058 | 3300009784 | Bacteria | 14636 |
| 39 | Ga0123353_10086760 | 3300010167 | Bacteria | 5041 |
| 40 | Ga0123353_10198847 | 3300010167 | Unclassified | 3155 |
| 41 | Ga0123353_10327568 | 3300010167 | Bacteria | 2321 |
| 42 | Ga0123354_10003426 | 3300010882 | Bacteria | 21887 |
| 43 | Ga0123354_10066490 | 3300010882 | Bacteria | 5263 |
| 44 | Ga0123354_11049676 | 3300010882 | Unclassified | 521 |
| 45 | Ga0466705_448626 | 3300042612 | Bacteria | 4715 |
| 46 | Ga0466711_024937 | 3300042615 | Bacteria | 5121 |
| 47 | Ga0466726_229999 | 3300042619 | Bacteria | 3044 |
| 48 | Ga0160445_100273 | 3300012847 | Bacteria | 35050 |
| 49 | Ga0466713_032671 | 3300042602 | Bacteria | 15195 |
| 50 | Ga0466717_310471 | 3300042604 | Bacteria | 1031 |
| 51 | IMNBL1DRAFT_c0000189 | 3300000062 | Bacteria | 53989 |
| 52 | JGI24702J35022_10022530 | 3300002462 | Bacteria | 3409 |
| 53 | JGI24702J35022_10352919 | 3300002462 | Unclassified | 879 |
| 54 | JGI24696J40584_12902438 | 3300002834 | Bacteria | 1194 |
| 55 | JGI24696J40584_12941266 | 3300002834 | Bacteria | 1702 |
| 56 | Ga0123357_10000231 | 3300009784 | Bacteria | 52963 |
| 57 | Ga0466733_113947 | 3300042659 | Unclassified | 1272 |
| 58 | Ga0466729_223571 | 3300042621 | Bacteria | 1487 |
| 59 | Ga0466735_011344 | 3300042624 | Bacteria | 2319 |
| 60 | Ga0466735_047757 | 3300042624 | Bacteria | 1007 |
| 61 | Ga0466704_294751 | 3300042643 | Bacteria | 11001 |
| 62 | Ga0123357_10004577 | 3300009784 | Bacteria | 16283 |
| 63 | Ga0123357_10190445 | 3300009784 | Bacteria | 2365 |
| 64 | Ga0123356_13368356 | 3300010049 | Bacteria | 555 |
| 65 | Ga0123353_10076324 | 3300010167 | Bacteria | 5384 |
| 66 | Ga0123353_10175053 | 3300010167 | Unclassified | 3403 |
| 67 | Ga0123354_10029953 | 3300010882 | Bacteria | 8553 |
| 68 | Ga0123354_10090896 | 3300010882 | Bacteria | 4222 |
| 69 | Ga0466723_227994 | 3300042618 | Bacteria | 16314 |
| 70 | Ga0160444_102365 | 3300012841 | Bacteria | 2921 |
| 71 | Ga0466694_284321 | 3300042594 | Bacteria | 1991 |
| 72 | Ga0466696_227726 | 3300042596 | Bacteria | 1068 |
| 73 | Ga0466701_102589 | 3300042598 | Bacteria | 16726 |
| 74 | Ga0466700_126894 | 3300042600 | Bacteria | 6628 |
| 75 | Ga0466707_026050 | 3300042601 | Bacteria | 15408 |
| 76 | Ga0466707_097852 | 3300042601 | Bacteria | 26513 |
| 77 | Ga0466713_082888 | 3300042602 | Bacteria | 4837 |
| 78 | Ga0466719_236675 | 3300042606 | Bacteria | 1298 |
| 79 | Ga0466722_122991 | 3300042609 | Bacteria | 9610 |
| 80 | 2227619069 | 2225789004 | Bacteria | 11849 |
| 81 | IMNBL1DRAFT_c0159057 | 3300000062 | Bacteria | 577 |
| 82 | JGI24702J35022_10225146 | 3300002462 | Bacteria | 1082 |
| 83 | JGI24702J35022_10981156 | 3300002462 | Bacteria | 526 |
| 84 | JGI24699J35502_11133947 | 3300002509 | Bacteria | 20626 |
| 85 | Ga0466730_043530 | 3300042625 | Bacteria | 1618 |
| 86 | Ga0466704_215539 | 3300042643 | Bacteria | 27907 |
| 87 | Ga0466704_403249 | 3300042643 | Bacteria | 2319 |
| 88 | Ga0466709_015483 | 3300042648 | Bacteria | 50381 |
| 89 | Ga0466727_029115 | 3300042655 | Bacteria | 1267 |
| 90 | Ga0123357_10018177 | 3300009784 | Bacteria | 9338 |
| 91 | Ga0123354_10193996 | 3300010882 | Bacteria | 2262 |
| 92 | Ga0466710_273254 | 3300042613 | Bacteria | 1232 |
| 93 | Ga0466711_394252 | 3300042615 | Bacteria | 3597 |
| 94 | Ga0466692_066865 | 3300042591 | Bacteria | 168349 |
| 95 | Ga0466692_082771 | 3300042591 | Bacteria | 1609 |
| 96 | Ga0466693_317690 | 3300042592 | Bacteria | 1041 |
| 97 | Ga0466700_416248 | 3300042600 | Bacteria | 1063 |
| 98 | Ga0466713_070449 | 3300042602 | Bacteria | 62168 |
| 99 | Ga0466713_093919 | 3300042602 | Bacteria | 3701 |
| 100 | Ga0466714_063404 | 3300042603 | Bacteria | 1372 |
| 101 | JGI24702J35022_10522199 | 3300002462 | Bacteria | 730 |
| 102 | JGI24699J35502_11134178 | 3300002509 | Bacteria | 45574 |
| 103 | Ga0072941_1422324 | 3300005201 | Bacteria | 691 |
| 104 | Ga0466729_220003 | 3300042621 | Bacteria | 6346 |
| 105 | Ga0466729_246205 | 3300042621 | Bacteria | 1125 |
| 106 | Ga0466735_188068 | 3300042624 | Bacteria | 5396 |
| 107 | Ga0466703_367008 | 3300042636 | Bacteria | 30950 |
| 108 | Ga0123357_10114425 | 3300009784 | Bacteria | 3425 |
| 109 | Ga0123357_10618486 | 3300009784 | Bacteria | 820 |
| 110 | Ga0123356_11130459 | 3300010049 | Bacteria | 951 |
| 111 | Ga0123356_11283962 | 3300010049 | Bacteria | 896 |
| 112 | Ga0123356_12325908 | 3300010049 | Bacteria | 670 |
| 113 | Ga0123356_12734031 | 3300010049 | Bacteria | 618 |
| 114 | Ga0123356_13585721 | 3300010049 | Bacteria | 537 |
| 115 | Ga0123353_10136901 | 3300010167 | Bacteria | 3927 |
| 116 | Ga0123353_10385497 | 3300010167 | Unclassified | 2094 |
| 117 | Ga0466715_498847 | 3300042616 | Bacteria | 14162 |
| 118 | Ga0466723_088640 | 3300042618 | Bacteria | 27215 |
| 119 | Ga0466726_280291 | 3300042619 | Bacteria | 1899 |
| 120 | Ga0160457_1000475 | 3300012858 | Unclassified | 18173 |
| 121 | Ga0466656_002889 | 3300042550 | Bacteria | 1181 |
| 122 | Ga0466707_241177 | 3300042601 | Bacteria | 2340 |
| 123 | Ga0466713_070806 | 3300042602 | Bacteria | 7191 |
| 124 | IMNBL1DRAFT_c0005676 | 3300000062 | Bacteria | 7046 |
| 125 | IMNBL1DRAFT_c0171641 | 3300000062 | Bacteria | 550 |
| 126 | Ga0068305_10106617 | 3300005083 | Bacteria | 7814 |
| 127 | Ga0068305_11069299 | 3300005083 | Bacteria | 516 |
| 128 | Ga0072941_1147571 | 3300005201 | Bacteria | 3799 |
| 129 | Ga0466735_227714 | 3300042624 | Bacteria | 4837 |
| 130 | Ga0123356_10121774 | 3300010049 | Bacteria | 2539 |
| 131 | Ga0123356_11049013 | 3300010049 | Bacteria | 984 |
| 132 | Ga0123354_10002668 | 3300010882 | Bacteria | 23860 |
| 133 | Ga0123354_10205614 | 3300010882 | Bacteria | 2147 |
| 134 | Ga0466705_500678 | 3300042612 | Bacteria | 2444 |
| 135 | Ga0466710_153644 | 3300042613 | Bacteria | 1592 |
| 136 | Ga0466726_214170 | 3300042619 | Bacteria | 1448 |
| 137 | Ga0160443_102194 | 3300012848 | Unclassified | 4685 |
| 138 | Ga0466693_347512 | 3300042592 | Bacteria | 1370 |
| 139 | Ga0466700_358297 | 3300042600 | Bacteria | 3451 |
| 140 | Ga0466707_259768 | 3300042601 | Bacteria | 3014 |
| 141 | Ga0466707_410463 | 3300042601 | Bacteria | 1671 |
| 142 | Ga0466713_041161 | 3300042602 | Unclassified | 3494 |
| 143 | Ga0466717_309617 | 3300042604 | Bacteria | 2122 |
| 144 | Ga0466722_231619 | 3300042609 | Bacteria | 16785 |
| 145 | 2227056480 | 2225789003 | Bacteria | 768 |
| 146 | 2227540248 | 2225789004 | Bacteria | 607 |
| 147 | Ga0123357_10000751 | 3300009784 | Bacteria | 32682 |
| 148 | Ga0466735_001596 | 3300042624 | Unclassified | 2622 |
| 149 | Ga0466735_019429 | 3300042624 | Bacteria | 6757 |
| 150 | Ga0466735_103977 | 3300042624 | Bacteria | 4844 |
| 151 | Ga0466703_142432 | 3300042636 | Bacteria | 5786 |
| 152 | Ga0466709_368385 | 3300042648 | Bacteria | 5187 |
| 153 | Ga0123357_10013195 | 3300009784 | Bacteria | 10705 |
| 154 | Ga0123356_11099010 | 3300010049 | Bacteria | 963 |
| 155 | Ga0123356_12959115 | 3300010049 | Bacteria | 593 |
| 156 | Ga0123353_10326567 | 3300010167 | Bacteria | 2325 |
| 157 | Ga0123353_11295049 | 3300010167 | Unclassified | 947 |
| 158 | Ga0123354_10020086 | 3300010882 | Bacteria | 10502 |
| 159 | Ga0123354_10421331 | 3300010882 | Bacteria | 1109 |
| 160 | Ga0466705_398599 | 3300042612 | Bacteria | 3625 |
| 161 | Ga0466715_337561 | 3300042616 | Bacteria | 7957 |
| 162 | Ga0466726_060177 | 3300042619 | Bacteria | 18658 |
| 163 | Ga0466726_301342 | 3300042619 | Bacteria | 1863 |
| 164 | Ga0466729_102152 | 3300042621 | Bacteria | 10671 |
| 165 | Ga0466692_043899 | 3300042591 | Bacteria | 67267 |
| 166 | Ga0466692_143216 | 3300042591 | Bacteria | 12372 |
| 167 | Ga0466706_020919 | 3300042599 | Bacteria | 2094 |
| 168 | Ga0466700_025319 | 3300042600 | Bacteria | 13456 |
| 169 | Ga0466707_085817 | 3300042601 | Bacteria | 16403 |
| 170 | IMNBGM34_c000006 | 3300000036 | Bacteria | 62887 |
| 171 | IMNBL1DRAFT_c0002181 | 3300000062 | Bacteria | 13807 |
| 172 | JGI24702J35022_10011304 | 3300002462 | Bacteria | 4977 |
| 173 | JGI24696J40584_12844345 | 3300002834 | Bacteria | 963 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF02033 | RBFA | Ribosome-binding factor A | 19 | 123 | 0.92 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF02033 | GO:0006364 | rRNA processing | BP |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.