Protein Family IF05910

Metagenome Isolate
241 Members
94 Samples
201 Scaffolds
347.78 Avg Length

🧬 Representative Sequence

ID
3300042601|Ga0466707_228633|Ga0466707_228633_56000_57274
Length
415 aa
Sequence
MIESYADKNKQKNDDFSVDDLDDFGNPITDEVGGSFGTHVRMLSPDKESLDFEDTSHDYALRPKRLVDYIGQESVTDNLQVFIEAAKLRGEPLDHVLFYGPPGLGKTTLAGIIAQELGVEIRITSGPAIERAGDLASILTNLSEGDVLFIDEIHRLNRSAEEILYSAMEDFELDMIIGKGPSAKSYRIPLPKFTMIGATTRAGSLSAPLRDRFGVMCKFELYSEDALKSIIARTASLLDAPIDDASLLELASRSRGTPRIANRLLKRVRDFAQVKSDGSIGLDIAKSTLDSLGIDGIGLEKVDRDILKLIIEKFLGGPVGIDTISAAIGEERITIEDVYEPYLLQKGLIHRTPKGRIASQDAYIHLGLEDLLRTSRAYGGASSSDLANVKGSGFEINDGELIIDRGTQISIYDEE

πŸ“Š Sample Types

Isolate 16.6%
Metagenome 83.4%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Unclassified 34.5%
Termitidae 25.3%
Kalotermitidae 13.8%
Drosophilidae 3.4%
Rhinotermitidae 3.4%
Armadillidiidae 3.4%
Formicidae 2.3%
Passalidae 2.3%
Tenebrionidae 2.3%
Termopsidae 2.3%
Hydrophilidae 1.1%
Apidae 1.1%
Hodotermitidae 1.1%
Scarabaeidae 1.1%
Culicidae 1.1%
Bombycidae 1.1%

🌳 Taxonomy

Archaea 0
Bacteria 232
Eukaryota 0
Viruses 0
Unclassified 9

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 2855361764 Lysinibacillus fusiformis Juneja Isolate Drosophilidae
2 2898741527 Sphingobacterium sp. xlx-73 Isolate
3 2590828840 Clostridium sp. 2 Isolate Termitidae
4 2820442516 Unclassified Firmicutes Lab288P3bin200 Isolate Unclassified
5 2820481688 Unclassified Firmicutes Lab288P1bin76 Isolate Unclassified
6 2820537337 Unclassified Firmicutes Lab288P1bin137 Isolate Unclassified
7 2820606014 Unclassified Firmicutes Emb289P1bin49 Isolate Unclassified
8 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
9 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
10 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
11 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
12 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
13 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
14 2890957088 Psychrobacillus lasiicapitis NEAU-3TGS17 Isolate Formicidae
15 2751185832 Lysinibacillus sp. AR18-8 Isolate Unclassified
16 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
17 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
18 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
19 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
20 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
21 3300012847 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG Metagenome Armadillidiidae
22 2873776654 Pedobacter sp. HDW13 Isolate Hydrophilidae
23 2820406809 Unclassified Firmicutes Lab288P4bin87 Isolate Unclassified
24 2820661146 Unclassified Firmicutes Co191P3bin61 Isolate Unclassified
25 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
26 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
27 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
28 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
29 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
30 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
31 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
32 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
33 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
34 3300012818 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E0 MG Metagenome
35 2827179085 Paenibacillus alvei DSM 29 Isolate Apidae
36 2852123468 Lysinibacillus sphaericus KCCM 35418 Isolate Unclassified
37 2820466401 Unclassified Firmicutes Lab288P3bin111 Isolate Unclassified
38 2820709481 Unclassified Firmicutes Co191P1bin30 Isolate Unclassified
39 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
40 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
41 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
42 3300056814 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) Metagenome Tenebrionidae
43 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
44 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
45 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
46 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
47 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
48 3300002931 Ant worker gut metagenome for colony PL010 Metagenome Formicidae
49 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
50 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
51 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
52 3300012829 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG Metagenome Armadillidiidae
53 2896350215 Sphingobacterium sp. xlx-183 Isolate
54 2574180310 Bacillus licheniformis CG-B52 Isolate Unclassified
55 2593339124 Clostridium sp. 4 Isolate Termitidae
56 2820412446 Unclassified Firmicutes Lab288P4bin39 Isolate Unclassified
57 2820497731 Unclassified Firmicutes Lab288P1bin55 Isolate Unclassified
58 2820587002 Unclassified Firmicutes Emb289P1bin94 Isolate Unclassified
59 2820690275 Unclassified Firmicutes Co191P1bin72 Isolate Unclassified
60 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
61 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
62 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
63 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
64 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
65 3300012798 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E6 MG Metagenome
66 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
67 2852337885 Paenibacillus protaetiae FW100M-2 Isolate Scarabaeidae
68 2896330536 Sphingobacterium sp. xlx-96 Isolate
69 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
70 2820282995 Unclassified Firmicutes Th196P3bin147 Isolate Unclassified
71 2820357977 Unclassified Firmicutes Nt197P3bin136 Isolate Unclassified
72 2820464928 Unclassified Firmicutes Lab288P3bin121 Isolate Unclassified
73 2820535361 Unclassified Firmicutes Lab288P1bin14 Isolate Unclassified
74 2820647881 Unclassified Firmicutes Cu122P5bin16 Isolate Unclassified
75 3300007143 Drosophila gut microbial communities from New York, USA - Drosophila putrida female 3 gut Metagenome Drosophilidae
76 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
77 3300012832 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E6 MG Metagenome Culicidae
78 2896321640 Sphingobacterium sp. xlx-130 Isolate
79 2820499546 Unclassified Firmicutes Lab288P1bin54 Isolate Unclassified
80 8064531044 Terrisporobacter mayombei DSM 6539 Isolate Unclassified
81 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
82 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
83 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
84 3300007085 Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut Metagenome Drosophilidae
85 3300012837 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG Metagenome Armadillidiidae
86 2579779088 Sphingobacterium paucimobilis HER1398 Isolate Bombycidae
87 2820296961 Unclassified Firmicutes Th196P3bin102 Isolate Unclassified
88 2820432912 Unclassified Firmicutes Lab288P3bin219 Isolate Unclassified
89 2820530790 Unclassified Firmicutes Lab288P1bin141 Isolate Unclassified
90 2820598593 Unclassified Firmicutes Emb289P1bin53 Isolate Unclassified
91 2820711732 Unclassified Firmicutes Co191P1bin26 Isolate Unclassified
92 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae
93 2989309576 Sporomusa termitida DSM 4440 Isolate Unclassified
94 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466729_269933 3300042621 Bacteria 2016
2 Ga0466704_038894 3300042643 Bacteria 5146
3 Ga0466711_098730 3300042615 Bacteria 8349
4 Ga0160458_100179 3300012832 Unclassified 49781
5 Ga0415639_004917 3300038395 Bacteria 26720
6 Ga0123355_10039120 3300009826 Bacteria 7714
7 Ga0123355_10264988 3300009826 Bacteria 2397
8 Ga0123355_10303706 3300009826 Bacteria 2172
9 Ga0123356_10027462 3300010049 Bacteria 5333
10 Ga0123356_10185605 3300010049 Bacteria 2106
11 Ga0123353_10052866 3300010167 Bacteria 6490
12 Ga0123353_10106375 3300010167 Bacteria 4520
13 Ga0123353_10150857 3300010167 Bacteria 3711
14 Ga0123353_10355765 3300010167 Bacteria 2203
15 Ga0160454_100023 3300012798 Bacteria 304777
16 Ga0466707_375914 3300042601 Bacteria 14333
17 Ga0466713_053492 3300042602 Bacteria 12914
18 Ga0466713_095410 3300042602 Bacteria 56118
19 Ga0466705_125845 3300042612 Bacteria 9297
20 Ga0466705_385246 3300042612 Bacteria 20984
21 Ga0562378_0258 3300056814 Bacteria 120735
22 Ga0562377_0850 3300056842 Unclassified 40600
23 Ga0466727_145325 3300042655 Bacteria 108337
24 Ga0466710_254246 3300042613 Bacteria 1521
25 Ga0466728_373999 3300042620 Bacteria 5077
26 Ga0160432_100037 3300012818 Bacteria 189678
27 Ga0415639_006216 3300038395 Bacteria 33213
28 Ga0466690_046734 3300042590 Bacteria 10843
29 Ga0466696_064170 3300042596 Bacteria 3032
30 Ga0123357_10050947 3300009784 Bacteria 5601
31 Ga0123355_10184638 3300009826 Bacteria 3087
32 Ga0123355_10347270 3300009826 Bacteria 1970
33 Ga0123356_10022428 3300010049 Bacteria 5963
34 Ga0123356_10429365 3300010049 Bacteria 1465
35 Ga0123353_10084418 3300010167 Bacteria 5112
36 Ga0123353_10128316 3300010167 Bacteria 4072
37 Ga0123354_10001138 3300010882 Bacteria 31037
38 Ga0466707_243724 3300042601 Bacteria 73222
39 Ga0466713_094570 3300042602 Bacteria 104024
40 IMNBL1DRAFT_c0001163 3300000062 Bacteria 20049
41 JGI24695J34938_10061952 3300002450 Bacteria 1591
42 JGI24702J35022_10001835 3300002462 Bacteria 13078
43 Ga0466697_120725 3300042611 Bacteria 3889
44 Ga0466733_087638 3300042659 Bacteria 4995
45 Ga0466729_251560 3300042621 Bacteria 19499
46 Ga0466729_270201 3300042621 Bacteria 4939
47 Ga0466730_066627 3300042625 Bacteria 1642
48 Ga0466704_144687 3300042643 Bacteria 21194
49 Ga0466704_290717 3300042643 Bacteria 1851
50 Ga0466709_210699 3300042648 Bacteria 76873
51 Ga0466711_432215 3300042615 Bacteria 9739
52 Ga0466715_362727 3300042616 Bacteria 24199
53 Ga0466690_146851 3300042590 Bacteria 110739
54 Ga0123355_10006456 3300009826 Bacteria 17375
55 Ga0123355_10109540 3300009826 Bacteria 4319
56 Ga0123355_10305133 3300009826 Bacteria 2165
57 Ga0123356_10009284 3300010049 Bacteria 9716
58 Ga0123356_10070488 3300010049 Bacteria 3279
59 Ga0123356_10131273 3300010049 Bacteria 2455
60 Ga0123356_10205500 3300010049 Bacteria 2013
61 Ga0123356_10362379 3300010049 Bacteria 1577
62 Ga0123356_10508985 3300010049 Bacteria 1361
63 Ga0123353_10036008 3300010167 Bacteria 7749
64 Ga0123353_10048503 3300010167 Bacteria 6762
65 Ga0123353_10112724 3300010167 Bacteria 4378
66 Ga0466719_015454 3300042606 Bacteria 2364
67 Ga0466721_068902 3300042608 Bacteria 33916
68 Ga0466721_365255 3300042608 Bacteria 1780
69 Ga0466721_385725 3300042608 Bacteria 6058
70 Ga0466722_187245 3300042609 Bacteria 2912
71 IMNBL1DRAFT_c0000847 3300000062 Bacteria 24007
72 Ga0466697_184080 3300042611 Bacteria 1438
73 Ga0466704_325789 3300042643 Bacteria 17195
74 Ga0466725_261721 3300042654 Bacteria 2464
75 Ga0466711_432158 3300042615 Bacteria 11250
76 Ga0466723_217114 3300042618 Bacteria 22855
77 Ga0466729_167110 3300042621 Bacteria 6450
78 Ga0466696_260550 3300042596 Bacteria 25366
79 Ga0466696_346326 3300042596 Bacteria 2799
80 Ga0466696_460737 3300042596 Bacteria 5297
81 Ga0123357_10008879 3300009784 Bacteria 12626
82 Ga0123355_10031627 3300009826 Bacteria 8586
83 Ga0123355_10147525 3300009826 Unclassified 3582
84 Ga0123356_10005233 3300010049 Bacteria 13249
85 Ga0123356_10420803 3300010049 Bacteria 1478
86 Ga0123353_10001369 3300010167 Bacteria 29946
87 Ga0123353_10042006 3300010167 Bacteria 7228
88 Ga0123353_10103293 3300010167 Bacteria 4594
89 Ga0123353_10218404 3300010167 Bacteria 2984
90 Ga0123353_10300473 3300010167 Bacteria 2451
91 Ga0466707_175167 3300042601 Bacteria 3034
92 Ga0466707_227821 3300042601 Bacteria 1449
93 Ga0466719_100408 3300042606 Bacteria 6247
94 Ga0104045_1001357 3300007085 Bacteria 5412
95 Ga0466733_081613 3300042659 Bacteria 2372
96 Ga0466704_559247 3300042643 Bacteria 4083
97 Ga0466724_24057 3300042649 Bacteria 30314
98 Ga0466725_100373 3300042654 Bacteria 14067
99 Ga0466723_213992 3300042618 Bacteria 12938
100 Ga0160467_100207 3300012829 Bacteria 76785
101 Ga0160455_103592 3300012837 Unclassified 2286
102 Ga0160445_103820 3300012847 Bacteria 2910
103 Ga0123356_10034630 3300010049 Bacteria 4719
104 Ga0123356_10050240 3300010049 Bacteria 3881
105 Ga0123356_10053862 3300010049 Bacteria 3745
106 Ga0123353_10345949 3300010167 Bacteria 2243
107 Ga0123353_10386796 3300010167 Unclassified 2089
108 Ga0123353_10409035 3300010167 Bacteria 2016
109 Ga0123353_10656703 3300010167 Bacteria 1483
110 Ga0123353_10837011 3300010167 Bacteria 1264
111 Ga0466701_078505 3300042598 Bacteria 86539
112 Ga0466706_140836 3300042599 Bacteria 3005
113 Ga0466719_179138 3300042606 Bacteria 4170
114 2227080765 2225789004 Bacteria 420563
115 2227386345 2225789004 Bacteria 27406
116 JGI24705J35276_12168697 3300002504 Unclassified 1278
117 Ga0466705_213682 3300042612 Bacteria 4433
118 Ga0466729_206171 3300042621 Bacteria 17094
119 Ga0466725_220046 3300042654 Bacteria 2130
120 Ga0466727_032342 3300042655 Bacteria 9121
121 Ga0466718_041810 3300042617 Bacteria 1883
122 Ga0466726_157288 3300042619 Bacteria 9132
123 Ga0466692_135382 3300042591 Bacteria 6967
124 Ga0123357_10266234 3300009784 Bacteria 1801
125 Ga0123356_10000010 3300010049 Bacteria 220063
126 Ga0123356_10002684 3300010049 Bacteria 18884
127 Ga0123356_10047455 3300010049 Bacteria 3996
128 Ga0123356_10066899 3300010049 Bacteria 3365
129 Ga0123356_10246733 3300010049 Bacteria 1860
130 Ga0123356_10323561 3300010049 Bacteria 1656
131 Ga0123356_10503334 3300010049 Bacteria 1368
132 Ga0123353_10001991 3300010167 Bacteria 25237
133 Ga0123353_10076850 3300010167 Bacteria 5365
134 Ga0123353_10441459 3300010167 Bacteria 1920
135 Ga0123353_10563627 3300010167 Bacteria 1639
136 Ga0123353_10610336 3300010167 Bacteria 1556
137 Ga0123354_10068850 3300010882 Bacteria 5140
138 Ga0123354_10101352 3300010882 Bacteria 3889
139 Ga0466707_001650 3300042601 Bacteria 9325
140 Ga0466707_332562 3300042601 Bacteria 9494
141 2227164158 2225789004 Bacteria 8319
142 IMNBL1DRAFT_c0000890 3300000062 Bacteria 23235
143 JGI24702J35022_10158298 3300002462 Bacteria 1274
144 CVPL010W_10000817 3300002931 Bacteria 59122
145 Ga0466705_381475 3300042612 Bacteria 18732
146 Ga0466703_028031 3300042636 Bacteria 4134
147 Ga0466703_170876 3300042636 Bacteria 15506
148 Ga0466724_61407 3300042649 Bacteria 12825
149 Ga0466708_012099 3300042652 Bacteria 3374
150 Ga0466725_042126 3300042654 Bacteria 2674
151 Ga0415639_015925 3300038395 Bacteria 8338
152 Ga0415639_049645 3300038395 Bacteria 3524
153 Ga0466693_160411 3300042592 Bacteria 2569
154 Ga0466696_309810 3300042596 Bacteria 11351
155 Ga0123355_10004203 3300009826 Bacteria 20921
156 Ga0123355_10030491 3300009826 Bacteria 8739
157 Ga0123356_10020054 3300010049 Bacteria 6331
158 Ga0123356_10029730 3300010049 Bacteria 5115
159 Ga0123356_10031761 3300010049 Bacteria 4942
160 Ga0123356_10033612 3300010049 Bacteria 4795
161 Ga0123356_10105676 3300010049 Bacteria 2709
162 Ga0123356_10115742 3300010049 Bacteria 2598
163 Ga0123353_10009874 3300010167 Bacteria 13233
164 Ga0123353_10021511 3300010167 Bacteria 9684
165 Ga0123353_10163185 3300010167 Unclassified 3545
166 Ga0123353_10166514 3300010167 Bacteria 3503
167 Ga0123353_10191820 3300010167 Bacteria 3224
168 Ga0123354_10136832 3300010882 Bacteria 3057
169 Ga0466701_072917 3300042598 Bacteria 3995
170 Ga0466707_041872 3300042601 Bacteria 7587
171 Ga0466707_135212 3300042601 Bacteria 4570
172 Ga0466707_193078 3300042601 Unclassified 16060
173 Ga0466713_017636 3300042602 Bacteria 3972
174 Ga0466714_117080 3300042603 Bacteria 1705
175 Ga0466719_358226 3300042606 Bacteria 6104
176 2227480187 2225789004 Bacteria 78142
177 JGI24695J34938_10000359 3300002450 Bacteria 45052
178 Ga0466705_271926 3300042612 Bacteria 148499
179 Ga0466704_183110 3300042643 Unclassified 15584
180 Ga0466724_48085 3300042649 Bacteria 9642
181 Ga0466708_282915 3300042652 Bacteria 14159
182 Ga0466725_372654 3300042654 Bacteria 18397
183 Ga0466715_589871 3300042616 Bacteria 16320
184 Ga0264413_105678 3300024493 Bacteria 11183
185 Ga0415639_047196 3300038395 Bacteria 16338
186 Ga0123357_10181277 3300009784 Bacteria 2458
187 Ga0123357_10184460 3300009784 Bacteria 2425
188 Ga0123356_10045384 3300010049 Bacteria 4089
189 Ga0123356_10183383 3300010049 Bacteria 2117
190 Ga0123356_10298961 3300010049 Bacteria 1714
191 Ga0123356_10341777 3300010049 Bacteria 1617
192 Ga0123356_10401897 3300010049 Bacteria 1508
193 Ga0123353_10000056 3300010167 Bacteria 127423
194 Ga0466707_202459 3300042601 Bacteria 205011
195 Ga0466707_228633 3300042601 Bacteria 65594
196 Ga0466713_009411 3300042602 Bacteria 34425
197 Ga0466713_084078 3300042602 Bacteria 6249
198 Ga0466719_198652 3300042606 Bacteria 3658
199 2227501038 2225789004 Bacteria 3798
200 Ga0104045_1074423 3300007085 Bacteria 3279
201 Ga0104048_1002375 3300007143 Bacteria 9067

πŸ“‹ Family Sequences

#SampleScaffoldProteinLength (aa)
1 2225789004 2227080765 2227448907 332
2 3300009784 Ga0123357_10184460 Ga0123357_101844602 332
3 3300042602 Ga0466713_095410 Ga0466713_095410_41121_42119 332
4 3300042616 Ga0466715_362727 Ga0466715_362727_175_1173 332
5 3300042625 Ga0466730_066627 Ga0466730_066627_314_1312 332
6 3300042648 Ga0466709_210699 Ga0466709_210699_22812_23810 332
7 3300056814 Ga0562378_0258 Ga0562378_0258_115348_116439 332
8 3300056842 Ga0562377_0850 Ga0562377_0850_6866_7957 332
9 3300002462 JGI24702J35022_10001835 JGI24702J35022_100018359 333
10 3300009826 Ga0123355_10347270 Ga0123355_103472702 333
11 3300010167 Ga0123353_10001369 Ga0123353_100013693 333
12 3300038395 Ga0415639_049645 Ga0415639_049645_1540_2541 333
13 3300042621 Ga0466729_269933 Ga0466729_269933_798_1799 333
14 3300042659 Ga0466733_087638 Ga0466733_087638_347_1348 333
15 iso_pr_bacteria 2820481688 2820482377 333
16 iso_pr_bacteria 2820598593 2820599749 333
17 3300009826 Ga0123355_10004203 Ga0123355_1000420310 334
18 3300009826 Ga0123355_10109540 Ga0123355_101095403 334
19 3300042654 Ga0466725_372654 Ga0466725_372654_16073_17077 334
20 iso_pr_bacteria 2574180310 2576357763 334
21 iso_pr_bacteria 2751185832 2753508514 334
22 iso_pr_bacteria 2820499546 2820500745 334
23 iso_pr_bacteria 2820537337 2820538179 334
24 iso_pr_bacteria 2820709481 2820710832 334
25 iso_pr_bacteria 2852123468 2852125762 334
26 iso_pr_bacteria 2852337885 2852338105 334
27 iso_pr_bacteria 2855361764 2855363632 334
28 3300000062 IMNBL1DRAFT_c0000890 IMNBL1DRAFT_00008906 335
29 3300009826 Ga0123355_10147525 Ga0123355_101475252 335
30 3300009826 Ga0123355_10264988 Ga0123355_102649882 335
31 3300010049 Ga0123356_10205500 Ga0123356_102055002 335
32 3300038395 Ga0415639_015925 Ga0415639_015925_7156_8163 335
33 3300042601 Ga0466707_041872 Ga0466707_041872_1483_2490 335
34 3300042649 Ga0466724_48085 Ga0466724_48085_3321_4328 335
35 3300009826 Ga0123355_10006456 Ga0123355_100064563 336
36 3300010049 Ga0123356_10429365 Ga0123356_104293652 336
37 3300042596 Ga0466696_309810 Ga0466696_309810_3550_4560 336
38 3300042643 Ga0466704_290717 Ga0466704_290717_47_1057 336
39 3300042654 Ga0466725_220046 Ga0466725_220046_67_1077 336
40 iso_pr_bacteria 2827179085 2827182723 336
41 iso_pr_bacteria 2890957088 2890960372 336
42 3300010167 Ga0123353_10837011 Ga0123353_108370112 337
43 3300042598 Ga0466701_072917 Ga0466701_072917_1875_2888 337
44 3300042615 Ga0466711_432158 Ga0466711_432158_3458_4498 337
45 3300042654 Ga0466725_042126 Ga0466725_042126_161_1174 337
46 3300042654 Ga0466725_100373 Ga0466725_100373_6253_7266 337
47 iso_pr_bacteria 2820296961 2820298086 337
48 iso_pr_bacteria 2820535361 2820535780 337
49 3300000062 IMNBL1DRAFT_c0001163 IMNBL1DRAFT_000116314 338
50 3300009826 Ga0123355_10039120 Ga0123355_100391206 338
51 3300009826 Ga0123355_10184638 Ga0123355_101846383 338
52 3300009826 Ga0123355_10305133 Ga0123355_103051331 338
53 3300010167 Ga0123353_10166514 Ga0123353_101665146 338
54 3300012798 Ga0160454_100023 Ga0160454_100023231 338
55 iso_pr_bacteria 2820406809 2820408247 338
56 iso_pr_bacteria 8064531044 8064534654 338
57 3300010167 Ga0123353_10386796 Ga0123353_103867962 339
58 3300010882 Ga0123354_10001138 Ga0123354_1000113810 339
59 3300010882 Ga0123354_10136832 Ga0123354_101368322 339
60 3300042602 Ga0466713_084078 Ga0466713_084078_3846_4865 339
61 3300042598 Ga0466701_078505 Ga0466701_078505_84478_85500 340
62 3300042601 Ga0466707_202459 Ga0466707_202459_14614_15636 340
63 3300042613 Ga0466710_254246 Ga0466710_254246_223_1245 340
64 3300042649 Ga0466724_24057 Ga0466724_24057_21359_22381 340
65 3300042649 Ga0466724_61407 Ga0466724_61407_9962_10984 340
66 iso_pr_bacteria 2579779088 2582238150 340
67 iso_pr_bacteria 2873776654 2873781440 340
68 iso_pr_bacteria 2896321640 2896322960 340
69 iso_pr_bacteria 2896330536 2896331331 340
70 iso_pr_bacteria 2896350215 2896351508 340
71 iso_pr_bacteria 2898741527 2898742497 340
72 3300002931 CVPL010W_10000817 CVPL010W_1000081713 341
73 3300007085 Ga0104045_1001357 Ga0104045_10013575 341
74 3300007085 Ga0104045_1074423 Ga0104045_10744233 341
75 3300007143 Ga0104048_1002375 Ga0104048_10023753 341
76 3300012818 Ga0160432_100037 Ga0160432_10003733 341
77 3300012829 Ga0160467_100207 Ga0160467_1002076 341
78 3300010167 Ga0123353_10441459 Ga0123353_104414592 342
79 3300042601 Ga0466707_001650 Ga0466707_001650_4203_5231 342
80 3300042601 Ga0466707_243724 Ga0466707_243724_45331_46359 342
81 3300042643 Ga0466704_325789 Ga0466704_325789_4186_5214 342
82 iso_pr_bacteria 2820432912 2820435261 342
83 iso_pr_bacteria 2820530790 2820533085 342
84 2225789004 2227164158 2227575854 343
85 2225789004 2227480187 2227939240 343
86 3300010049 Ga0123356_10022428 Ga0123356_100224286 343
87 3300012832 Ga0160458_100179 Ga0160458_10017931 343
88 3300012837 Ga0160455_103592 Ga0160455_1035922 343
89 3300012847 Ga0160445_103820 Ga0160445_1038201 343
90 3300024493 Ga0264413_105678 Ga0264413_1056782 343
91 3300042608 Ga0466721_068902 Ga0466721_068902_16885_17916 343
92 3300042617 Ga0466718_041810 Ga0466718_041810_467_1498 343
93 3300042636 Ga0466703_028031 Ga0466703_028031_709_1926 343
94 iso_pr_bacteria 2820497731 2820498073 343
95 3300000062 IMNBL1DRAFT_c0000847 IMNBL1DRAFT_00008476 344
96 3300010049 Ga0123356_10070488 Ga0123356_100704883 345
97 3300038395 Ga0415639_047196 Ga0415639_047196_8429_9466 345
98 3300002462 JGI24702J35022_10158298 JGI24702J35022_101582981 346
99 3300010049 Ga0123356_10362379 Ga0123356_103623792 346
100 3300010167 Ga0123353_10218404 Ga0123353_102184043 346
101 3300042608 Ga0466721_365255 Ga0466721_365255_583_1623 346
102 3300042612 Ga0466705_381475 Ga0466705_381475_16242_17282 346
103 iso_pr_bacteria 2820711732 2820712260 346
104 iso_pr_bacteria 2989309576 2989311887 346
105 3300010049 Ga0123356_10033612 Ga0123356_100336123 347
106 3300042643 Ga0466704_559247 Ga0466704_559247_1943_2986 347
107 iso_pr_bacteria 2590828840 2593255214 347
108 iso_pr_bacteria 2593339124 2595062765 347
109 3300010049 Ga0123356_10508985 Ga0123356_105089852 348
110 3300042606 Ga0466719_179138 Ga0466719_179138_79_1125 348
111 3300042615 Ga0466711_432215 Ga0466711_432215_1328_2374 348
112 iso_pr_bacteria 2820606014 2820606715 348
113 3300009826 Ga0123355_10031627 Ga0123355_100316276 349
114 3300038395 Ga0415639_004917 Ga0415639_004917_6984_8033 349
115 3300042601 Ga0466707_375914 Ga0466707_375914_470_1519 349
116 3300042602 Ga0466713_009411 Ga0466713_009411_6338_7387 349
117 3300042606 Ga0466719_100408 Ga0466719_100408_1548_2681 349
118 3300042611 Ga0466697_120725 Ga0466697_120725_570_1619 349
119 3300042621 Ga0466729_251560 Ga0466729_251560_18275_19324 349
120 iso_pr_bacteria 2820464928 2820465831 349
121 3300010049 Ga0123356_10115742 Ga0123356_101157423 350
122 3300010049 Ga0123356_10183383 Ga0123356_101833834 350
123 3300010167 Ga0123353_10009874 Ga0123353_1000987410 350
124 3300010167 Ga0123353_10084418 Ga0123353_100844186 350
125 3300042592 Ga0466693_160411 Ga0466693_160411_488_1540 350
126 3300042599 Ga0466706_140836 Ga0466706_140836_556_1608 350
127 3300042618 Ga0466723_217114 Ga0466723_217114_12698_13750 350
128 3300042621 Ga0466729_270201 Ga0466729_270201_559_1611 350
129 3300042652 Ga0466708_282915 Ga0466708_282915_5582_6634 350
130 iso_pr_bacteria 2820647881 2820647981 350
131 2225789004 2227386345 2227831139 351
132 3300010049 Ga0123356_10047455 Ga0123356_100474555 351
133 3300042601 Ga0466707_193078 Ga0466707_193078_1590_2684 351
134 3300042602 Ga0466713_017636 Ga0466713_017636_1696_2751 351
135 3300042602 Ga0466713_094570 Ga0466713_094570_70871_71926 351
136 3300042606 Ga0466719_198652 Ga0466719_198652_824_1879 351
137 3300042612 Ga0466705_125845 Ga0466705_125845_3261_4316 351
138 3300042612 Ga0466705_213682 Ga0466705_213682_1542_2597 351
139 3300042643 Ga0466704_144687 Ga0466704_144687_3039_4094 351
140 iso_pr_bacteria 2820442516 2820444437 351
141 iso_pr_bacteria 2820466401 2820466972 351
142 iso_pr_bacteria 2820661146 2820661598 351
143 iso_pr_bacteria 2820690275 2820690636 351
144 3300002450 JGI24695J34938_10000359 JGI24695J34938_1000035938 352
145 3300002504 JGI24705J35276_12168697 JGI24705J35276_121686972 352
146 3300009784 Ga0123357_10008879 Ga0123357_100088794 352
147 3300009826 Ga0123355_10030491 Ga0123355_100304912 352
148 3300010049 Ga0123356_10000010 Ga0123356_1000001029 352
149 3300010049 Ga0123356_10002684 Ga0123356_100026844 352
150 3300010049 Ga0123356_10009284 Ga0123356_100092849 352
151 3300010049 Ga0123356_10020054 Ga0123356_100200542 352
152 3300010049 Ga0123356_10029730 Ga0123356_100297303 352
153 3300010049 Ga0123356_10031761 Ga0123356_100317612 352
154 3300010049 Ga0123356_10034630 Ga0123356_100346306 352
155 3300010049 Ga0123356_10045384 Ga0123356_100453842 352
156 3300010049 Ga0123356_10053862 Ga0123356_100538622 352
157 3300010049 Ga0123356_10066899 Ga0123356_100668994 352
158 3300010049 Ga0123356_10105676 Ga0123356_101056762 352
159 3300010049 Ga0123356_10246733 Ga0123356_102467331 352
160 3300010049 Ga0123356_10298961 Ga0123356_102989612 352
161 3300010049 Ga0123356_10323561 Ga0123356_103235612 352
162 3300010049 Ga0123356_10401897 Ga0123356_104018972 352
163 3300010049 Ga0123356_10420803 Ga0123356_104208032 352
164 3300010049 Ga0123356_10503334 Ga0123356_105033342 352
165 3300010167 Ga0123353_10000056 Ga0123353_1000005644 352
166 3300010167 Ga0123353_10001991 Ga0123353_1000199118 352
167 3300010167 Ga0123353_10052866 Ga0123353_100528664 352
168 3300010167 Ga0123353_10106375 Ga0123353_101063753 352
169 3300010167 Ga0123353_10163185 Ga0123353_101631852 352
170 3300010167 Ga0123353_10300473 Ga0123353_103004732 352
171 3300010167 Ga0123353_10656703 Ga0123353_106567031 352
172 3300038395 Ga0415639_006216 Ga0415639_006216_2856_3914 352
173 3300042596 Ga0466696_346326 Ga0466696_346326_531_1589 352
174 3300042596 Ga0466696_460737 Ga0466696_460737_3554_4612 352
175 3300042602 Ga0466713_053492 Ga0466713_053492_6848_7921 352
176 3300042618 Ga0466723_213992 Ga0466723_213992_6637_7695 352
177 3300042636 Ga0466703_170876 Ga0466703_170876_11244_12302 352
178 3300042655 Ga0466727_032342 Ga0466727_032342_6438_7496 352
179 iso_pr_bacteria 2820587002 2820587339 352
180 3300009784 Ga0123357_10181277 Ga0123357_101812772 353
181 3300010049 Ga0123356_10050240 Ga0123356_100502403 353
182 3300010167 Ga0123353_10355765 Ga0123353_103557652 353
183 3300042590 Ga0466690_146851 Ga0466690_146851_80644_81705 353
184 3300042596 Ga0466696_064170 Ga0466696_064170_1896_2957 353
185 3300042603 Ga0466714_117080 Ga0466714_117080_84_1145 353
186 3300042606 Ga0466719_015454 Ga0466719_015454_808_1869 353
187 3300042611 Ga0466697_184080 Ga0466697_184080_108_1169 353
188 3300042621 Ga0466729_206171 Ga0466729_206171_14545_15606 353
189 3300042643 Ga0466704_038894 Ga0466704_038894_3421_4482 353
190 iso_pr_bacteria 2820282995 2820284113 353
191 3300010049 Ga0123356_10341777 Ga0123356_103417771 354
192 3300010167 Ga0123353_10563627 Ga0123353_105636272 354
193 3300042590 Ga0466690_046734 Ga0466690_046734_6071_7135 354
194 3300042601 Ga0466707_227821 Ga0466707_227821_37_1101 354
195 3300042601 Ga0466707_332562 Ga0466707_332562_337_1401 354
196 3300010167 Ga0123353_10610336 Ga0123353_106103361 355
197 3300042596 Ga0466696_260550 Ga0466696_260550_23773_24840 355
198 3300042606 Ga0466719_358226 Ga0466719_358226_388_1455 355
199 3300042612 Ga0466705_271926 Ga0466705_271926_20240_21307 355
200 3300042612 Ga0466705_385246 Ga0466705_385246_18226_19293 355
201 3300042619 Ga0466726_157288 Ga0466726_157288_3479_4546 355
202 3300042620 Ga0466728_373999 Ga0466728_373999_630_1697 355
203 3300042643 Ga0466704_183110 Ga0466704_183110_7776_8843 355
204 3300010049 Ga0123356_10005233 Ga0123356_100052339 356
205 3300010167 Ga0123353_10021511 Ga0123353_100215114 356
206 3300010167 Ga0123353_10048503 Ga0123353_100485038 356
207 3300010167 Ga0123353_10076850 Ga0123353_100768506 356
208 3300010167 Ga0123353_10112724 Ga0123353_101127244 356
209 3300010167 Ga0123353_10128316 Ga0123353_101283164 356
210 3300010167 Ga0123353_10150857 Ga0123353_101508572 356
211 3300010167 Ga0123353_10191820 Ga0123353_101918203 356
212 3300010167 Ga0123353_10345949 Ga0123353_103459491 356
213 3300010167 Ga0123353_10409035 Ga0123353_104090353 356
214 3300042652 Ga0466708_012099 Ga0466708_012099_826_1896 356
215 3300010049 Ga0123356_10027462 Ga0123356_100274623 357
216 3300042608 Ga0466721_385725 Ga0466721_385725_334_1407 357
217 3300042616 Ga0466715_589871 Ga0466715_589871_9476_10549 357
218 3300009826 Ga0123355_10303706 Ga0123355_103037061 358
219 3300042615 Ga0466711_098730 Ga0466711_098730_5221_6297 358
220 3300010167 Ga0123353_10103293 Ga0123353_101032936 359
221 3300042655 Ga0466727_145325 Ga0466727_145325_18117_19298 359
222 3300002450 JGI24695J34938_10061952 JGI24695J34938_100619521 360
223 3300042621 Ga0466729_167110 Ga0466729_167110_2873_3955 360
224 3300042654 Ga0466725_261721 Ga0466725_261721_828_1928 360
225 3300042659 Ga0466733_081613 Ga0466733_081613_155_1237 360
226 3300010882 Ga0123354_10101352 Ga0123354_101013524 361
227 3300010049 Ga0123356_10131273 Ga0123356_101312732 362
228 3300010049 Ga0123356_10185605 Ga0123356_101856052 362
229 3300010167 Ga0123353_10036008 Ga0123353_100360086 362
230 3300010167 Ga0123353_10042006 Ga0123353_100420068 362
231 iso_pr_bacteria 2820357977 2820358832 364
232 3300009784 Ga0123357_10266234 Ga0123357_102662342 366
233 3300042591 Ga0466692_135382 Ga0466692_135382_652_1758 368
234 3300042601 Ga0466707_135212 Ga0466707_135212_2164_3276 370
235 3300010882 Ga0123354_10068850 Ga0123354_100688505 372
236 3300042601 Ga0466707_175167 Ga0466707_175167_1359_2477 372
237 3300042609 Ga0466722_187245 Ga0466722_187245_1779_2897 372
238 3300009784 Ga0123357_10050947 Ga0123357_100509473 377
239 2225789004 2227501038 2227983780 392
240 iso_pr_bacteria 2820412446 2820413790 401
241 3300042601 Ga0466707_228633 Ga0466707_228633_56000_57274 415

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF17864 AAA_lid_4 RuvB AAA lid domain 222 295 0.99
PF05496 RuvB_N Holliday junction DNA helicase RuvB P-loop domain 61 218 0.99
PF05491 RuvB_C RuvB C-terminal winged helix domain 298 366 0.98
PF00004 AAA ATPase family associated with various cellular activities (AAA) 96 220 0.96
PF07728 AAA_5 AAA domain (dynein-related subfamily) 95 213 0.9

βš›οΈ Structure & Feature Viewer

pLDDTpTMQuality
0.78 0.89 High

Powered by Feature Viewer

Powered by PDBe Molstar

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.