Protein Family IF05892
Metagenome
Isolate
173
Members
72
Samples
157
Scaffolds
260.15
Avg Length
Representative Sequence
- ID
- 3300042601|Ga0466707_203571|Ga0466707_203571_33824_34693
- Length
- 289 aa
- Sequence
- MQAFFTRGFLFSEICVTFVGFFSINKMRSNQTYVKPKKFLGQHFLKDLSVAQRIAETLPLTEKTAVLEIGPGTGVLTQFLLQNPNIDLTVVELDRESVPYLRTHFPALENRIIEGDFLKLDLSAVFKEKFFIIGNYPYNISSQIFFKLLDYREQVPCLTGMIQKEVAERIAAPHGSKTYGILSVLLQAYYNVEYLFTVDERVFDPPPKVKSAVVRLTRNEVEKIDCDEVLFKTVVKTAFNQRRKTLRNSLKSLIDKDNEISRKAIFDKRPEQLSVAQFIELTNIIRSNV
Sample Types
Isolate
9.2%
Metagenome
90.8%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
40.8%
Kalotermitidae
19.7%
Unclassified
18.3%
Rhinotermitidae
5.6%
Termopsidae
4.2%
Blattidae
4.2%
Passalidae
4.2%
Hodotermitidae
1.4%
Elmidae
1.4%
Taxonomy
Archaea
0
Bacteria
164
Eukaryota
0
Viruses
0
Unclassified
9
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 2 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 3 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 4 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 5 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 6 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 7 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 8 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 9 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 10 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 11 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 12 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 13 | 2820795054 | Unclassified Bacteroidetes Cu122P1bin21 | Isolate | Unclassified |
| 14 | 2820755292 | Unclassified Bacteroidetes Nc150P3bin3 | Isolate | Unclassified |
| 15 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 16 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 17 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 18 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 19 | 2820792843 | Unclassified Bacteroidetes Cu122P3bin1 | Isolate | Unclassified |
| 20 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 21 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 22 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 23 | 2820783511 | Unclassified Bacteroidetes Emb289P3bin108 | Isolate | Unclassified |
| 24 | 2820788205 | Unclassified Bacteroidetes Emb289P1bin57 | Isolate | Unclassified |
| 25 | 2820750388 | Unclassified Bacteroidetes Nt197P3bin50 | Isolate | Unclassified |
| 26 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 27 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 28 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 29 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 30 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 31 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 32 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 33 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 34 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 35 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 36 | 2820770630 | Unclassified Bacteroidetes Lab288P3bin130 | Isolate | Unclassified |
| 37 | 2910959314 | Dysgonomonas sp. 511 | Isolate | Blattidae |
| 38 | 2820746860 | Unclassified Bacteroidetes Th196P3bin126 | Isolate | Unclassified |
| 39 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 40 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 41 | 3300000036 | Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) | Metagenome | Passalidae |
| 42 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 43 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 44 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 45 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 46 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 47 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 48 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 49 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 50 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 51 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 52 | 2940336608 | Dysgonomonas sp. PH5-37 | Isolate | Blattidae |
| 53 | 2820753519 | Unclassified Bacteroidetes Nc150P4bin20 | Isolate | Unclassified |
| 54 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 55 | 2998907766 | Penaeicola halotolerans LMIT005 | Isolate | |
| 56 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 57 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 58 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 59 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 60 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 61 | 2864836148 | Arcicella rosea S00070 | Isolate | Elmidae |
| 62 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 63 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 64 | 2910942425 | Dysgonomonas sp. 521 | Isolate | Blattidae |
| 65 | 2820735654 | Unclassified Bacteroidetes Th196P4bin9 | Isolate | Unclassified |
| 66 | 8100166142 | Dysgonomonas sp. GY75 | Isolate | Rhinotermitidae |
| 67 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 68 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 69 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 70 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 71 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 72 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_281055 | 3300042612 | Bacteria | 4651 |
| 2 | Ga0466733_078914 | 3300042659 | Bacteria | 1818 |
| 3 | Ga0123356_10199343 | 3300010049 | Bacteria | 2040 |
| 4 | Ga0466701_080033 | 3300042598 | Bacteria | 9894 |
| 5 | Ga0466706_052254 | 3300042599 | Bacteria | 103343 |
| 6 | Ga0466706_165084 | 3300042599 | Bacteria | 195712 |
| 7 | Ga0466706_205853 | 3300042599 | Bacteria | 29572 |
| 8 | Ga0466698_486063 | 3300042610 | Bacteria | 3891 |
| 9 | Ga0466731_247175 | 3300042622 | Bacteria | 1788 |
| 10 | Ga0466703_153148 | 3300042636 | Unclassified | 1234 |
| 11 | Ga0466703_195941 | 3300042636 | Bacteria | 9036 |
| 12 | Ga0466703_224078 | 3300042636 | Bacteria | 3064 |
| 13 | Ga0466709_208437 | 3300042648 | Bacteria | 82349 |
| 14 | Ga0466709_292660 | 3300042648 | Bacteria | 19708 |
| 15 | Ga0466727_196399 | 3300042655 | Unclassified | 14093 |
| 16 | Ga0466656_170227 | 3300042550 | Bacteria | 6523 |
| 17 | Ga0466694_306687 | 3300042594 | Bacteria | 1058 |
| 18 | Ga0466699_263270 | 3300042597 | Bacteria | 2912 |
| 19 | Ga0466705_399901 | 3300042612 | Bacteria | 19786 |
| 20 | Ga0466710_059442 | 3300042613 | Bacteria | 2921 |
| 21 | Ga0466711_479274 | 3300042615 | Bacteria | 4105 |
| 22 | IMNBL1DRAFT_c0009469 | 3300000062 | Bacteria | 4806 |
| 23 | JGI24696J40584_12908273 | 3300002834 | Bacteria | 1235 |
| 24 | JGI24696J40584_12960314 | 3300002834 | Bacteria | 6889 |
| 25 | Ga0123355_10420877 | 3300009826 | Bacteria | 1707 |
| 26 | Ga0123356_10001616 | 3300010049 | Bacteria | 24710 |
| 27 | Ga0123353_10050932 | 3300010167 | Bacteria | 6607 |
| 28 | Ga0123353_11284450 | 3300010167 | Unclassified | 952 |
| 29 | Ga0466707_113510 | 3300042601 | Bacteria | 5951 |
| 30 | Ga0466707_203571 | 3300042601 | Bacteria | 51511 |
| 31 | Ga0466713_122628 | 3300042602 | Bacteria | 2382 |
| 32 | Ga0466714_130620 | 3300042603 | Bacteria | 2736 |
| 33 | Ga0466717_115988 | 3300042604 | Bacteria | 1174 |
| 34 | Ga0466719_547610 | 3300042606 | Bacteria | 15297 |
| 35 | Ga0466735_206990 | 3300042624 | Bacteria | 4647 |
| 36 | Ga0466703_258103 | 3300042636 | Bacteria | 8306 |
| 37 | Ga0466724_27156 | 3300042649 | Bacteria | 1723 |
| 38 | Ga0466708_027852 | 3300042652 | Bacteria | 35083 |
| 39 | Ga0466657_037970 | 3300042582 | Bacteria | 3044 |
| 40 | Ga0466690_012565 | 3300042590 | Bacteria | 4957 |
| 41 | Ga0466691_010908 | 3300042593 | Bacteria | 139266 |
| 42 | Ga0466694_245546 | 3300042594 | Bacteria | 1679 |
| 43 | Ga0466694_317240 | 3300042594 | Bacteria | 2449 |
| 44 | Ga0466696_010048 | 3300042596 | Bacteria | 35433 |
| 45 | Ga0466696_443536 | 3300042596 | Bacteria | 2229 |
| 46 | Ga0466711_313429 | 3300042615 | Bacteria | 90458 |
| 47 | Ga0466728_476207 | 3300042620 | Bacteria | 2935 |
| 48 | IMNBL1DRAFT_c0033869 | 3300000062 | Bacteria | 1825 |
| 49 | IMNBL1DRAFT_c0062532 | 3300000062 | Bacteria | 1111 |
| 50 | Ga0123357_10276782 | 3300009784 | Bacteria | 1742 |
| 51 | Ga0123356_10092834 | 3300010049 | Bacteria | 2879 |
| 52 | Ga0123353_10000087 | 3300010167 | Bacteria | 103477 |
| 53 | Ga0123353_10124894 | 3300010167 | Bacteria | 4136 |
| 54 | Ga0123353_10778719 | 3300010167 | Bacteria | 1325 |
| 55 | Ga0466700_230275 | 3300042600 | Bacteria | 9161 |
| 56 | Ga0466713_143155 | 3300042602 | Bacteria | 188721 |
| 57 | Ga0466714_022595 | 3300042603 | Bacteria | 225972 |
| 58 | Ga0466722_031037 | 3300042609 | Bacteria | 32845 |
| 59 | Ga0466730_072635 | 3300042625 | Bacteria | 2672 |
| 60 | Ga0466704_145321 | 3300042643 | Bacteria | 17421 |
| 61 | Ga0466704_215098 | 3300042643 | Bacteria | 4910 |
| 62 | Ga0466709_299038 | 3300042648 | Bacteria | 23402 |
| 63 | Ga0466724_43697 | 3300042649 | Bacteria | 3008 |
| 64 | Ga0466656_227132 | 3300042550 | Bacteria | 3726 |
| 65 | Ga0466691_042421 | 3300042593 | Bacteria | 2642 |
| 66 | Ga0466729_158636 | 3300042621 | Bacteria | 1402 |
| 67 | JGI24696J40584_12957662 | 3300002834 | Bacteria | 3629 |
| 68 | Ga0466697_082837 | 3300042611 | Bacteria | 1573 |
| 69 | Ga0466733_127180 | 3300042659 | Bacteria | 3868 |
| 70 | Ga0123353_10000454 | 3300010167 | Bacteria | 50966 |
| 71 | Ga0123353_10041882 | 3300010167 | Unclassified | 7239 |
| 72 | Ga0466714_033452 | 3300042603 | Bacteria | 32073 |
| 73 | Ga0466722_079607 | 3300042609 | Bacteria | 6732 |
| 74 | Ga0466704_060132 | 3300042643 | Bacteria | 107799 |
| 75 | Ga0415639_111417 | 3300038395 | Bacteria | 2261 |
| 76 | Ga0466694_005178 | 3300042594 | Bacteria | 5595 |
| 77 | Ga0466694_070624 | 3300042594 | Bacteria | 3049 |
| 78 | Ga0466696_276511 | 3300042596 | Bacteria | 1737 |
| 79 | Ga0466710_029545 | 3300042613 | Bacteria | 2066 |
| 80 | Ga0466715_290683 | 3300042616 | Bacteria | 15704 |
| 81 | Ga0466715_614578 | 3300042616 | Unclassified | 17723 |
| 82 | Ga0466732_210914 | 3300042656 | Bacteria | 2811 |
| 83 | Ga0123353_10149655 | 3300010167 | Bacteria | 3728 |
| 84 | Ga0466720_190499 | 3300042607 | Bacteria | 2863 |
| 85 | Ga0466729_288856 | 3300042621 | Bacteria | 3178 |
| 86 | Ga0466657_227524 | 3300042582 | Bacteria | 11726 |
| 87 | Ga0466715_472298 | 3300042616 | Bacteria | 24908 |
| 88 | Ga0466723_329006 | 3300042618 | Bacteria | 14408 |
| 89 | Ga0466726_044086 | 3300042619 | Bacteria | 2652 |
| 90 | Ga0466726_226827 | 3300042619 | Bacteria | 12877 |
| 91 | Ga0466726_357657 | 3300042619 | Bacteria | 1132 |
| 92 | Ga0466728_284998 | 3300042620 | Bacteria | 1025 |
| 93 | 2227661030 | 2225789004 | Unclassified | 1948 |
| 94 | IMNBL1DRAFT_c0041569 | 3300000062 | Bacteria | 1542 |
| 95 | IMNBL1DRAFT_c0049805 | 3300000062 | Bacteria | 1333 |
| 96 | JGI24705J35276_12213318 | 3300002504 | Bacteria | 1921 |
| 97 | JGI24696J40584_12947637 | 3300002834 | Bacteria | 1959 |
| 98 | Ga0068305_10054148 | 3300005083 | Bacteria | 8956 |
| 99 | Ga0466697_167565 | 3300042611 | Bacteria | 1413 |
| 100 | Ga0466732_225136 | 3300042656 | Bacteria | 4486 |
| 101 | Ga0466733_053801 | 3300042659 | Bacteria | 13129 |
| 102 | Ga0466733_062768 | 3300042659 | Bacteria | 36272 |
| 103 | Ga0123355_10000003 | 3300009826 | Bacteria | 224088 |
| 104 | Ga0123356_10164103 | 3300010049 | Bacteria | 2223 |
| 105 | Ga0123356_10264983 | 3300010049 | Bacteria | 1804 |
| 106 | Ga0123353_10273061 | 3300010167 | Bacteria | 2603 |
| 107 | Ga0123353_10504574 | 3300010167 | Bacteria | 1761 |
| 108 | Ga0466701_049985 | 3300042598 | Bacteria | 3909 |
| 109 | Ga0466714_021845 | 3300042603 | Bacteria | 9532 |
| 110 | Ga0466703_013048 | 3300042636 | Bacteria | 4340 |
| 111 | Ga0466690_157440 | 3300042590 | Bacteria | 5692 |
| 112 | Ga0466692_012515 | 3300042591 | Bacteria | 55028 |
| 113 | Ga0466693_234571 | 3300042592 | Bacteria | 1079 |
| 114 | Ga0466695_050157 | 3300042595 | Bacteria | 1992 |
| 115 | Ga0466696_430048 | 3300042596 | Bacteria | 4987 |
| 116 | Ga0466699_172121 | 3300042597 | Bacteria | 1968 |
| 117 | Ga0466701_001665 | 3300042598 | Bacteria | 23764 |
| 118 | Ga0466723_331915 | 3300042618 | Bacteria | 13100 |
| 119 | Ga0466726_383704 | 3300042619 | Bacteria | 3373 |
| 120 | IMNBGM34_c000048 | 3300000036 | Bacteria | 33252 |
| 121 | IMNBL1DRAFT_c0004799 | 3300000062 | Bacteria | 7973 |
| 122 | JGI24705J35276_12192497 | 3300002504 | Bacteria | 1488 |
| 123 | Ga0466705_296754 | 3300042612 | Bacteria | 4225 |
| 124 | Ga0123356_10370413 | 3300010049 | Bacteria | 1562 |
| 125 | Ga0123353_10000066 | 3300010167 | Bacteria | 114986 |
| 126 | Ga0123353_10004465 | 3300010167 | Bacteria | 18029 |
| 127 | Ga0123354_10499113 | 3300010882 | Unclassified | 950 |
| 128 | Ga0466714_013322 | 3300042603 | Bacteria | 11665 |
| 129 | Ga0466716_178418 | 3300042605 | Bacteria | 12563 |
| 130 | Ga0466719_153950 | 3300042606 | Bacteria | 3189 |
| 131 | Ga0466731_111621 | 3300042622 | Bacteria | 57892 |
| 132 | Ga0466730_023806 | 3300042625 | Bacteria | 2387 |
| 133 | Ga0466657_294673 | 3300042582 | Bacteria | 1811 |
| 134 | Ga0466701_014367 | 3300042598 | Bacteria | 4372 |
| 135 | Ga0466710_010282 | 3300042613 | Bacteria | 2160 |
| 136 | Ga0466723_208279 | 3300042618 | Bacteria | 2859 |
| 137 | Ga0466729_084681 | 3300042621 | Unclassified | 1429 |
| 138 | IMNBL1DRAFT_c0010857 | 3300000062 | Bacteria | 4311 |
| 139 | Ga0123353_10015471 | 3300010167 | Bacteria | 11084 |
| 140 | Ga0123353_11115102 | 3300010167 | Bacteria | 1046 |
| 141 | Ga0466706_144213 | 3300042599 | Bacteria | 16196 |
| 142 | Ga0466713_072434 | 3300042602 | Bacteria | 14880 |
| 143 | Ga0466714_068614 | 3300042603 | Bacteria | 5619 |
| 144 | Ga0466717_016641 | 3300042604 | Bacteria | 1567 |
| 145 | Ga0466717_234935 | 3300042604 | Unclassified | 1486 |
| 146 | Ga0466702_377914 | 3300042635 | Bacteria | 1659 |
| 147 | Ga0466656_115539 | 3300042550 | Bacteria | 1436 |
| 148 | Ga0466657_163901 | 3300042582 | Bacteria | 22614 |
| 149 | Ga0466690_264523 | 3300042590 | Bacteria | 5222 |
| 150 | Ga0466695_382977 | 3300042595 | Bacteria | 3269 |
| 151 | Ga0466695_396119 | 3300042595 | Bacteria | 2391 |
| 152 | Ga0466696_097270 | 3300042596 | Bacteria | 8217 |
| 153 | Ga0466710_097550 | 3300042613 | Bacteria | 3185 |
| 154 | Ga0466710_199024 | 3300042613 | Bacteria | 5826 |
| 155 | Ga0466715_580653 | 3300042616 | Bacteria | 5125 |
| 156 | JGI24702J35022_10000345 | 3300002462 | Bacteria | 27477 |
| 157 | JGI24696J40584_12961658 | 3300002834 | Bacteria | 29846 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00398 | RrnaAD | Ribosomal RNA adenine dimethylase | 36 | 285 | 0.91 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.