Protein Family IF05740
Metagenome
Isolate
252
Members
152
Samples
164
Scaffolds
126.4
Avg Length
Representative Sequence
- ID
- 3300042600|Ga0466700_302117|Ga0466700_302117_978_1451
- Length
- 127 aa
- Sequence
- MARVKGGSVSKTRRRKVLKRAKGYFGSKHRLYKTAQEQLFHSGAYAYRDRKQNKRNFRKLWITRINAACRDNEISYSKFINGLTKAEVNINRKMLAELAIDNPTAFSDLVTIAKESLNGKVKKEDKV
Sample Types
Isolate
34.9%
Metagenome
65.1%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
30.3%
Termitidae
20.0%
Apidae
11.7%
Kalotermitidae
6.9%
Tenebrionidae
4.8%
Culicidae
3.4%
Termopsidae
2.8%
Formicidae
2.8%
Armadillidiidae
2.8%
Rhinotermitidae
2.1%
Elmidae
2.1%
Scarabaeidae
2.1%
Hydrophilidae
1.4%
Cambaridae
1.4%
Cerambycidae
1.4%
Curculionidae
0.7%
Cimicidae
0.7%
Hodotermitidae
0.7%
Passalidae
0.7%
Pyralidae
0.7%
Siricidae
0.7%
Taxonomy
Archaea
0
Bacteria
233
Eukaryota
0
Viruses
0
Unclassified
19
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 8110340172 | Bifidobacterium choladohabitans B14384H11 | Isolate | Apidae |
| 2 | 2820909719 | Unclassified Actinobacteria Emb289P4bin20 | Isolate | Unclassified |
| 3 | 2865983822 | Bifidobacterium xylocopae XV2 | Isolate | Apidae |
| 4 | 2896955351 | Streptomyces sp. GF20 | Isolate | Termitidae |
| 5 | 2515154100 | Streptomyces sp. MspMP-M5 | Isolate | Unclassified |
| 6 | 2515154104 | Streptomyces sp. KhCrAH-244 | Isolate | Unclassified |
| 7 | 2519899775 | Bifidobacterium asteroides PRL2011 | Isolate | Apidae |
| 8 | 2597490239 | Bifidobacterium bohemicum DSM 22767 | Isolate | Unclassified |
| 9 | 2681812870 | Oerskovia enterophila DFA-19 | Isolate | Unclassified |
| 10 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 11 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 12 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 13 | 647000328 | Streptomyces sp. ACT-1 XylebKG-1 | Isolate | Curculionidae |
| 14 | 8067987626 | Agromyces larvae CFWR-12 | Isolate | Unclassified |
| 15 | 3300000333 | Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony | Metagenome | Apidae |
| 16 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 17 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 18 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 19 | 2820807258 | Unclassified Actinobacteria Nt197P3bin90 | Isolate | Unclassified |
| 20 | 2820849606 | Unclassified Actinobacteria Lab288P3bin39 | Isolate | Unclassified |
| 21 | 2820922474 | Unclassified Actinobacteria Emb289P3bin154 | Isolate | Unclassified |
| 22 | 2820926697 | Unclassified Actinobacteria Emb289P3bin125 | Isolate | Unclassified |
| 23 | 2865982043 | Bifidobacterium aemilianum XV10 | Isolate | Apidae |
| 24 | 2873586004 | Sanguibacter sp. HDW7 | Isolate | Hydrophilidae |
| 25 | 2505679068 | Isoptericola variabilis 225 | Isolate | Unclassified |
| 26 | 2513237174 | Bifidobacterium asteroides ATCC 25910 | Isolate | Apidae |
| 27 | 2645727657 | Bifidobacterium actinocoloniiforme DSM 22766 | Isolate | Unclassified |
| 28 | 2675903013 | Rhodococcus triatomae DSM 44892 | Isolate | Unclassified |
| 29 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 30 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 31 | 646564587 | Tsukamurella paurometabola 33, DSM 20162 | Isolate | Cimicidae |
| 32 | 8062637095 | Yimella sp. cx-51 | Isolate | Cambaridae |
| 33 | 8077783556 | Streptomyces sp. PLM4 | Isolate | Formicidae |
| 34 | 3300012818 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E0 MG | Metagenome | |
| 35 | 3300012834 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG | Metagenome | |
| 36 | 3300012857 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG | Metagenome | Culicidae |
| 37 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 38 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 39 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 40 | 2820814774 | Unclassified Actinobacteria Nt197P3bin39 | Isolate | Unclassified |
| 41 | 2820935937 | Unclassified Actinobacteria Emb289P1bin40 | Isolate | Unclassified |
| 42 | 2864964650 | Tsukamurella ocularis S00236 | Isolate | Elmidae |
| 43 | 2873589062 | Phycicoccus sp. HDW14 | Isolate | Hydrophilidae |
| 44 | 2884613238 | Agromyces intestinalis KACC 19306 | Isolate | Scarabaeidae |
| 45 | 2900354037 | Nocardia macrotermitis RB20 | Isolate | Termitidae |
| 46 | 2504756063 | Isoptericola variabilis J5 | Isolate | Unclassified |
| 47 | 2597490194 | Bifidobacterium coryneforme LMG 18911 | Isolate | Apidae |
| 48 | 2671180601 | Bifidobacterium asteroides DSM 20089 | Isolate | Unclassified |
| 49 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 50 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 51 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 52 | 3300056857 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) | Metagenome | Tenebrionidae |
| 53 | 3300057007 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) | Metagenome | Tenebrionidae |
| 54 | 8046957834 | Streptomyces coacervatus JCM 17138 | Isolate | Unclassified |
| 55 | 8109397740 | Rhodococcus triatomae DSM 44892 | Isolate | Unclassified |
| 56 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 57 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 58 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 59 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 60 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 61 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 62 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 63 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 64 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 65 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 66 | 8118075156 | Actinosynnema pretiosum DSM 44131 | Isolate | Unclassified |
| 67 | 2820897376 | Unclassified Actinobacteria Lab288P1bin101 | Isolate | Unclassified |
| 68 | 2873196663 | Streptomyces capitiformicae 1H-SSA4 | Isolate | Formicidae |
| 69 | 2908241010 | Streptomyces sp. HF10 | Isolate | Termitidae |
| 70 | 2912817845 | Streptomyces griseus SID164 | Isolate | |
| 71 | 2684622918 | Bifidobacterium asteroides Bi_198 | Isolate | Unclassified |
| 72 | 3300056790 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) | Metagenome | Tenebrionidae |
| 73 | 3300056856 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) | Metagenome | Tenebrionidae |
| 74 | 8024981139 | Bifidobacterium asteroides ESL0170 | Isolate | Apidae |
| 75 | 8024984606 | Bifidobacterium asteroides ESL0199 | Isolate | Apidae |
| 76 | 8030347546 | Propionimicrobium sp. PCR01-08-3 | Isolate | Tenebrionidae |
| 77 | 3006468911 | Streptomyces sp. RB17 | Isolate | Termitidae |
| 78 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 79 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 80 | 3300012813 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E11 MG | Metagenome | Culicidae |
| 81 | 3300012841 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E1 MG | Metagenome | Armadillidiidae |
| 82 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 83 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 84 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 85 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 86 | 2820867525 | Unclassified Actinobacteria Lab288P3bin128 | Isolate | Unclassified |
| 87 | 2820903739 | Unclassified Actinobacteria Emb289P4bin49 | Isolate | Unclassified |
| 88 | 2841168549 | Agromyces protaetiae FW100M-8 | Isolate | Scarabaeidae |
| 89 | 2864918810 | Tsukamurella ocularis S00175 | Isolate | Elmidae |
| 90 | 2879643867 | Bifidobacterium sp. wkB344 | Isolate | Apidae |
| 91 | 2884351759 | Cellulosimicrobium sp. BI34T | Isolate | Pyralidae |
| 92 | 2900368070 | Nocardia aurantia RB56 | Isolate | Termitidae |
| 93 | 2912749649 | Streptomyces sp. GS7 | Isolate | Termitidae |
| 94 | 2684622920 | Bifidobacterium asteroides Bi_200 | Isolate | Unclassified |
| 95 | 2802429577 | Bifidobacterium indicum DSM 20214 | Isolate | Unclassified |
| 96 | 8062747827 | Yimella sp. cx-51 | Isolate | Cambaridae |
| 97 | 3006461590 | Streptomyces sp. RB5 | Isolate | Termitidae |
| 98 | 3006667155 | Streptomyces sp. SID9727 | Isolate | |
| 99 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 100 | 3300012832 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E6 MG | Metagenome | Culicidae |
| 101 | 2820825283 | Unclassified Actinobacteria Nt197P3bin111 | Isolate | Unclassified |
| 102 | 2820911766 | Unclassified Actinobacteria Emb289P3bin96 | Isolate | Unclassified |
| 103 | 2883361506 | Luteimicrobium xylanilyticum HY-24 | Isolate | Cerambycidae |
| 104 | 2547132081 | Streptomyces sp. S4 | Isolate | Formicidae |
| 105 | 2660238275 | Bifidobacterium indicum DSM 20214 | Isolate | Unclassified |
| 106 | 2684622916 | Bifidobacterium asteroides Bi_170 | Isolate | Unclassified |
| 107 | 2684622917 | Bifidobacterium coryneforme Bi_197 | Isolate | Unclassified |
| 108 | 2693429521 | Bifidobacterium coryneforme DSM 20216 | Isolate | Unclassified |
| 109 | 2788500098 | Bombiscardovia coagulans DSM 22924 | Isolate | Apidae |
| 110 | 2816332114 | Microbacterium saperdae DSM 20169 | Isolate | Unclassified |
| 111 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 112 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 113 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 114 | 8012942269 | Mammaliicoccus lentus UD i2 | Isolate | Tenebrionidae |
| 115 | 8024982947 | Bifidobacterium asteroides ESL0200 | Isolate | Apidae |
| 116 | 8067071256 | Microbispora camponoti 2C-HV3 | Isolate | Formicidae |
| 117 | 3300005721 | Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 | Metagenome | Apidae |
| 118 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 119 | 3300012820 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E6 MG | Metagenome | Armadillidiidae |
| 120 | 3300012848 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG | Metagenome | Armadillidiidae |
| 121 | 2820857933 | Unclassified Actinobacteria Lab288P3bin173 | Isolate | Unclassified |
| 122 | 2523533511 | Streptomyces sp. Sv. ACTE SirexAA-E | Isolate | Siricidae |
| 123 | 2568526170 | Bifidobacterium sp. A11 | Isolate | Apidae |
| 124 | 2684622919 | Bifidobacterium asteroides Bi_199 | Isolate | Unclassified |
| 125 | 2731957681 | Xylanimicrobium pachnodae JCM 13526, NBRC 107786 | Isolate | Scarabaeidae |
| 126 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 127 | 8024986378 | Bifidobacterium asteroides ESL0198 | Isolate | Apidae |
| 128 | 8032009961 | Bifidobacterium indicum ESL0197 | Isolate | Apidae |
| 129 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 130 | 3300012805 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E11 MG | Metagenome | |
| 131 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 132 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 133 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 134 | 8110341875 | Bifidobacterium polysaccharolyticum W8117 | Isolate | Apidae |
| 135 | 2820842553 | Unclassified Actinobacteria Lab288P4bin104 | Isolate | Unclassified |
| 136 | 2820929059 | Unclassified Actinobacteria Emb289P3bin110 | Isolate | Unclassified |
| 137 | 2821314491 | Unclassified Actinobacteria Lab288P4bin49 | Isolate | Unclassified |
| 138 | 2862784999 | Streptomyces sp. M41 | Isolate | Unclassified |
| 139 | 2864773010 | Tsukamurella ocularis S00022 | Isolate | Elmidae |
| 140 | 2931430189 | Tessaracoccus palaemonis J1M15 | Isolate | |
| 141 | 2084038013 | Anoplophora glabripennis gut microbial communities from Worchester, Massachusetts, USA - Larvae | Metagenome | Cerambycidae |
| 142 | 2515154106 | Streptomyces sp. FxanaD5 | Isolate | Unclassified |
| 143 | 2772190761 | Rhodococcus rhodnii NRRL B-16535 | Isolate | Unclassified |
| 144 | 2808606957 | Bifidobacterium sp. ESL0447 | Isolate | Unclassified |
| 145 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 146 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 147 | 3300012824 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG | Metagenome | Armadillidiidae |
| 148 | 3300012831 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E6 MG | Metagenome | Culicidae |
| 149 | 3300012850 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E0 MG | Metagenome | Culicidae |
| 150 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 151 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 152 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_303636 | 3300042612 | Bacteria | 24054 |
| 2 | Ga0466735_182523 | 3300042624 | Bacteria | 1913 |
| 3 | Ga0466703_243743 | 3300042636 | Bacteria | 2593 |
| 4 | Ga0466703_294254 | 3300042636 | Bacteria | 32535 |
| 5 | Ga0466704_471258 | 3300042643 | Bacteria | 2742 |
| 6 | Ga0466704_496086 | 3300042643 | Bacteria | 23628 |
| 7 | Ga0466704_584103 | 3300042643 | Bacteria | 1612 |
| 8 | Ga0466725_126563 | 3300042654 | Bacteria | 2648 |
| 9 | Ga0466725_191658 | 3300042654 | Bacteria | 4989 |
| 10 | Ga0123356_10113553 | 3300010049 | Bacteria | 2621 |
| 11 | Ga0123356_10118310 | 3300010049 | Bacteria | 2572 |
| 12 | Ga0123354_10254284 | 3300010882 | Bacteria | 1771 |
| 13 | Ga0466705_526161 | 3300042612 | Bacteria | 3387 |
| 14 | Ga0466712_038777 | 3300042614 | Unclassified | 1351 |
| 15 | Ga0466723_050193 | 3300042618 | Bacteria | 10431 |
| 16 | Ga0466707_172072 | 3300042601 | Bacteria | 35013 |
| 17 | Ga0466713_130410 | 3300042602 | Bacteria | 4594 |
| 18 | Ga0466722_167438 | 3300042609 | Bacteria | 1333 |
| 19 | Ga0466693_336987 | 3300042592 | Bacteria | 29393 |
| 20 | Ga0466733_182321 | 3300042659 | Bacteria | 20892 |
| 21 | Ga0562375_0394 | 3300056856 | Bacteria | 98144 |
| 22 | Ga0466730_052607 | 3300042625 | Bacteria | 2035 |
| 23 | Ga0466724_09284 | 3300042649 | Bacteria | 258546 |
| 24 | Ga0123357_10487476 | 3300009784 | Bacteria | 1036 |
| 25 | Ga0123355_10029102 | 3300009826 | Bacteria | 8937 |
| 26 | Ga0123356_10001452 | 3300010049 | Bacteria | 26185 |
| 27 | Ga0123356_10014966 | 3300010049 | Bacteria | 7442 |
| 28 | Ga0123353_10151033 | 3300010167 | Bacteria | 3709 |
| 29 | Ga0123354_10541100 | 3300010882 | Bacteria | 883 |
| 30 | Ga0466700_171673 | 3300042600 | Bacteria | 1107 |
| 31 | Ga0160456_106322 | 3300012820 | Bacteria | 1383 |
| 32 | Ga0466693_003661 | 3300042592 | Unclassified | 1008 |
| 33 | Ga0466696_157668 | 3300042596 | Bacteria | 12455 |
| 34 | IMNBL1DRAFT_c0022190 | 3300000062 | Bacteria | 2518 |
| 35 | Ga0562379_2121 | 3300056790 | Bacteria | 17993 |
| 36 | Ga0466730_003610 | 3300042625 | Bacteria | 1325 |
| 37 | Ga0466730_035425 | 3300042625 | Bacteria | 1694 |
| 38 | Ga0466730_065352 | 3300042625 | Bacteria | 1516 |
| 39 | Ga0466730_078223 | 3300042625 | Bacteria | 1863 |
| 40 | Ga0466703_287964 | 3300042636 | Bacteria | 97243 |
| 41 | Ga0123357_10348229 | 3300009784 | Bacteria | 1422 |
| 42 | Ga0123357_10411402 | 3300009784 | Unclassified | 1218 |
| 43 | Ga0123356_10001300 | 3300010049 | Bacteria | 27630 |
| 44 | Ga0123354_10195404 | 3300010882 | Bacteria | 2247 |
| 45 | Ga0160464_111651 | 3300012805 | Bacteria | 720 |
| 46 | Ga0466705_432572 | 3300042612 | Unclassified | 2538 |
| 47 | Ga0466715_199734 | 3300042616 | Bacteria | 48945 |
| 48 | Ga0466723_174378 | 3300042618 | Bacteria | 2480 |
| 49 | Ga0466723_345655 | 3300042618 | Bacteria | 5035 |
| 50 | Ga0466719_114267 | 3300042606 | Bacteria | 1288 |
| 51 | Ga0466691_090922 | 3300042593 | Bacteria | 4064 |
| 52 | Ga0466696_113685 | 3300042596 | Bacteria | 2807 |
| 53 | Ga0466699_250486 | 3300042597 | Bacteria | 1206 |
| 54 | AustNasuHG_c1000830 | 3300000089 | Bacteria | 11098 |
| 55 | Ga0072940_1040757 | 3300005200 | Unclassified | 4545 |
| 56 | Ga0123357_10000125 | 3300009784 | Bacteria | 65500 |
| 57 | Ga0466705_242778 | 3300042612 | Bacteria | 2288 |
| 58 | Ga0466734_089701 | 3300042623 | Bacteria | 1140 |
| 59 | Ga0466703_012460 | 3300042636 | Bacteria | 2957 |
| 60 | Ga0466703_044102 | 3300042636 | Bacteria | 8229 |
| 61 | Ga0466704_301229 | 3300042643 | Bacteria | 7473 |
| 62 | Ga0466708_082419 | 3300042652 | Bacteria | 1122 |
| 63 | Ga0123357_10369824 | 3300009784 | Unclassified | 1345 |
| 64 | Ga0123353_10038228 | 3300010167 | Unclassified | 7541 |
| 65 | Ga0123354_10007867 | 3300010882 | Bacteria | 16144 |
| 66 | Ga0466726_281548 | 3300042619 | Bacteria | 1482 |
| 67 | Ga0466728_183401 | 3300042620 | Bacteria | 1022 |
| 68 | Ga0466701_021457 | 3300042598 | Bacteria | 1008 |
| 69 | Ga0160432_100328 | 3300012818 | Unclassified | 36754 |
| 70 | Ga0160469_101601 | 3300012824 | Bacteria | 5647 |
| 71 | Ga0160452_101462 | 3300012834 | Bacteria | 6740 |
| 72 | Ga0160443_100386 | 3300012848 | Bacteria | 37003 |
| 73 | Ga0160434_100015 | 3300012850 | Bacteria | 213534 |
| 74 | Ga0466692_000910 | 3300042591 | Bacteria | 9693 |
| 75 | Ga0466691_087935 | 3300042593 | Bacteria | 13535 |
| 76 | AglaG_GDN60OX02GB315 | 2084038013 | Bacteria | 529 |
| 77 | HBC_ctgsDRAFT_1001091 | 3300000333 | Unclassified | 5921 |
| 78 | JGI24699J35502_10967607 | 3300002509 | Bacteria | 1225 |
| 79 | JGI24699J35502_11112745 | 3300002509 | Bacteria | 2775 |
| 80 | Ga0074278_103126 | 3300005721 | Bacteria | 8568 |
| 81 | Ga0466733_064380 | 3300042659 | Bacteria | 8377 |
| 82 | Ga0466730_064157 | 3300042625 | Bacteria | 1600 |
| 83 | Ga0466708_170038 | 3300042652 | Bacteria | 2433 |
| 84 | Ga0123355_10049192 | 3300009826 | Bacteria | 6854 |
| 85 | Ga0123356_10084622 | 3300010049 | Bacteria | 3006 |
| 86 | Ga0123354_10000832 | 3300010882 | Bacteria | 33984 |
| 87 | Ga0466728_217338 | 3300042620 | Bacteria | 2346 |
| 88 | Ga0466706_235692 | 3300042599 | Bacteria | 1772 |
| 89 | Ga0466700_302117 | 3300042600 | Unclassified | 1582 |
| 90 | Ga0466707_191839 | 3300042601 | Bacteria | 3136 |
| 91 | Ga0466722_105025 | 3300042609 | Bacteria | 57830 |
| 92 | Ga0160469_100339 | 3300012824 | Bacteria | 26939 |
| 93 | JGI24705J35276_12071844 | 3300002504 | Bacteria | 955 |
| 94 | JGI24699J35502_11034164 | 3300002509 | Bacteria | 1530 |
| 95 | Ga0466697_090590 | 3300042611 | Bacteria | 1129 |
| 96 | Ga0466705_286903 | 3300042612 | Bacteria | 2065 |
| 97 | Ga0466729_282435 | 3300042621 | Bacteria | 2588 |
| 98 | Ga0466730_017781 | 3300042625 | Bacteria | 2446 |
| 99 | Ga0466727_154770 | 3300042655 | Bacteria | 4016 |
| 100 | Ga0123356_10000783 | 3300010049 | Bacteria | 35212 |
| 101 | Ga0123353_13255657 | 3300010167 | Bacteria | 519 |
| 102 | Ga0123354_10106788 | 3300010882 | Bacteria | 3733 |
| 103 | Ga0466705_415714 | 3300042612 | Bacteria | 1131 |
| 104 | Ga0466718_060823 | 3300042617 | Bacteria | 1283 |
| 105 | Ga0466728_291764 | 3300042620 | Bacteria | 1228 |
| 106 | Ga0466728_392643 | 3300042620 | Bacteria | 3802 |
| 107 | Ga0466719_138891 | 3300042606 | Bacteria | 99480 |
| 108 | Ga0466719_180931 | 3300042606 | Bacteria | 3757 |
| 109 | Ga0466719_521766 | 3300042606 | Bacteria | 2569 |
| 110 | Ga0160459_101542 | 3300012831 | Unclassified | 4849 |
| 111 | Ga0160452_100032 | 3300012834 | Bacteria | 218733 |
| 112 | Ga0466693_191161 | 3300042592 | Bacteria | 1172 |
| 113 | Ga0466696_046322 | 3300042596 | Bacteria | 1890 |
| 114 | JGI24705J35276_12029445 | 3300002504 | Bacteria | 886 |
| 115 | JGI24699J35502_10312334 | 3300002509 | Unclassified | 524 |
| 116 | Ga0072941_1532920 | 3300005201 | Bacteria | 1139 |
| 117 | Ga0562377_0022 | 3300056842 | Bacteria | 934669 |
| 118 | Ga0562376_0207 | 3300056857 | Bacteria | 119435 |
| 119 | Ga0562374_0004 | 3300057007 | Bacteria | 3025848 |
| 120 | Ga0466734_156022 | 3300042623 | Bacteria | 1039 |
| 121 | Ga0466724_24141 | 3300042649 | Bacteria | 5422 |
| 122 | Ga0123357_10838675 | 3300009784 | Unclassified | 611 |
| 123 | Ga0123356_10224125 | 3300010049 | Bacteria | 1939 |
| 124 | Ga0123353_10847596 | 3300010167 | Bacteria | 1253 |
| 125 | Ga0123353_11345153 | 3300010167 | Bacteria | 923 |
| 126 | Ga0123354_10595207 | 3300010882 | Unclassified | 813 |
| 127 | Ga0466723_003951 | 3300042618 | Bacteria | 30411 |
| 128 | Ga0466723_185249 | 3300042618 | Bacteria | 3999 |
| 129 | Ga0466707_278733 | 3300042601 | Unclassified | 5508 |
| 130 | Ga0466707_290431 | 3300042601 | Bacteria | 1457 |
| 131 | Ga0466714_111739 | 3300042603 | Bacteria | 3433 |
| 132 | Ga0466714_120437 | 3300042603 | Bacteria | 5156 |
| 133 | Ga0160470_106562 | 3300012813 | Unclassified | 1334 |
| 134 | Ga0160458_100648 | 3300012832 | Bacteria | 12114 |
| 135 | Ga0123357_10000097 | 3300009784 | Bacteria | 71551 |
| 136 | Ga0123357_10003579 | 3300009784 | Bacteria | 17895 |
| 137 | Ga0562377_0150 | 3300056842 | Bacteria | 201591 |
| 138 | Ga0562376_0118 | 3300056857 | Bacteria | 180422 |
| 139 | Ga0466729_314129 | 3300042621 | Bacteria | 1610 |
| 140 | Ga0466735_081152 | 3300042624 | Bacteria | 1558 |
| 141 | Ga0466703_135101 | 3300042636 | Bacteria | 119691 |
| 142 | Ga0466724_38492 | 3300042649 | Bacteria | 3648 |
| 143 | Ga0123357_10024107 | 3300009784 | Bacteria | 8186 |
| 144 | Ga0123357_10088239 | 3300009784 | Bacteria | 4054 |
| 145 | Ga0123357_10564277 | 3300009784 | Unclassified | 898 |
| 146 | Ga0123356_11142180 | 3300010049 | Bacteria | 946 |
| 147 | Ga0123353_10000478 | 3300010167 | Bacteria | 49513 |
| 148 | Ga0123354_10830368 | 3300010882 | Bacteria | 617 |
| 149 | Ga0466705_455707 | 3300042612 | Bacteria | 1911 |
| 150 | Ga0466715_029089 | 3300042616 | Bacteria | 1738 |
| 151 | Ga0466723_194944 | 3300042618 | Bacteria | 2187 |
| 152 | Ga0466706_079956 | 3300042599 | Bacteria | 1674 |
| 153 | Ga0466707_336552 | 3300042601 | Bacteria | 1667 |
| 154 | Ga0466713_086140 | 3300042602 | Bacteria | 54502 |
| 155 | Ga0466722_076355 | 3300042609 | Bacteria | 2131 |
| 156 | Ga0160432_102280 | 3300012818 | Bacteria | 4351 |
| 157 | Ga0160444_120416 | 3300012841 | Bacteria | 729 |
| 158 | Ga0160443_116737 | 3300012848 | Unclassified | 787 |
| 159 | Ga0160435_1047854 | 3300012857 | Bacteria | 578 |
| 160 | Ga0466696_021349 | 3300042596 | Bacteria | 3132 |
| 161 | AglaG_contig12530 | 2084038013 | Bacteria | 1242 |
| 162 | JGI24699J35502_11109246 | 3300002509 | Unclassified | 2625 |
| 163 | JGI24699J35502_11133717 | 3300002509 | Bacteria | 14136 |
| 164 | Ga0068302_10035208 | 3300005071 | Bacteria | 1679 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00453 | Ribosomal_L20 | Ribosomal protein L20 | 3 | 109 | 0.99 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.