Protein Family IF05730
Metagenome
Isolate
362
Members
128
Samples
297
Scaffolds
222.33
Avg Length
Representative Sequence
- ID
- 3300042600|Ga0466700_233578|Ga0466700_233578_350_1141
- Length
- 263 aa
- Sequence
- LRYLLSKTEGRLRLRITKKNEFFLVILSACAIFASKQINEFKKMDVKIEQSWKNCLMTEFEKPYFRQLTDFVREEYKKGTVYPPGAFIFNAFNHCPFDKVQVVLLGQDPYHEPGQAHGLCFSVREGTRFPPSLINIFKEVQSDLGMPTPKSGDLTRWADQGVLLLNATLTVRAHAAGSHQNKGWETFTDAVITSLATRREHLVYILWGAYAQRKGAMIDTTKNLILQSPHPSPLSASRGFFGNKHFSKANAYLIESGQTSIEW
Sample Types
Isolate
18.0%
Metagenome
82.0%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Blattidae
26.6%
Termitidae
21.8%
Unclassified
14.5%
Kalotermitidae
11.3%
Rhinotermitidae
4.8%
Tenebrionidae
4.0%
Termopsidae
3.2%
Drosophilidae
2.4%
Formicidae
1.6%
Passalidae
1.6%
Hydrophilidae
1.6%
Elmidae
1.6%
Aphididae
0.8%
Euphausiidae
0.8%
Dytiscidae
0.8%
Calliphoridae
0.8%
Vespidae
0.8%
Hodotermitidae
0.8%
Taxonomy
Archaea
0
Bacteria
354
Eukaryota
1
Viruses
0
Unclassified
7
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2695420317 | Dysgonomonas sp. HGC4 | Isolate | Unclassified |
| 2 | 2922326829 | Bacteroides sp. 224 | Isolate | Blattidae |
| 3 | 2940253009 | Dysgonomonas sp. PF1-23 | Isolate | Blattidae |
| 4 | 2940257232 | Dysgonomonas sp. PFB1-18 | Isolate | Blattidae |
| 5 | 2940313741 | Parabacteroides sp. PH5-17 | Isolate | Blattidae |
| 6 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 7 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 8 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 9 | 3300007085 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut | Metagenome | Drosophilidae |
| 10 | 3300009460 | Microbial communities of aphids from Pistacia texana in Langtry, TX, USA - Geopemphigus sp. seqcov | Metagenome | |
| 11 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 12 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 13 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 14 | 2830041218 | Bacteroides reticulotermitis DSM 105720 | Isolate | Unclassified |
| 15 | 2890957088 | Psychrobacillus lasiicapitis NEAU-3TGS17 | Isolate | Formicidae |
| 16 | 2910930387 | Dysgonomonas sp. 216 | Isolate | Blattidae |
| 17 | 2910942425 | Dysgonomonas sp. 521 | Isolate | Blattidae |
| 18 | 2940212447 | Parabacteroides sp. PH5-16 | Isolate | Blattidae |
| 19 | 2940244548 | Dysgonomonas sp. PF1-14 | Isolate | Blattidae |
| 20 | 2940302308 | Parabacteroides sp. PF5-5 | Isolate | Blattidae |
| 21 | 2940321370 | Parabacteroides sp. PH5-39 | Isolate | Blattidae |
| 22 | 2940332795 | Parabacteroides sp. PH5-8 | Isolate | Blattidae |
| 23 | 3004672520 | Bacteroides sp. 51 | Isolate | Blattidae |
| 24 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 25 | 3300056790 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) | Metagenome | Tenebrionidae |
| 26 | 3300056856 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) | Metagenome | Tenebrionidae |
| 27 | 8100166142 | Dysgonomonas sp. GY75 | Isolate | Rhinotermitidae |
| 28 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 29 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 30 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 31 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 32 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 33 | 2636416028 | Pelosinus propionicus DSM 13327 | Isolate | Unclassified |
| 34 | 2873600114 | Dysgonomonas sp. HDW5A | Isolate | Hydrophilidae |
| 35 | 2940193328 | Dysgonomonas sp. PH5-45 | Isolate | Blattidae |
| 36 | 2940346213 | Parabacteroides sp. PFB2-12 | Isolate | Blattidae |
| 37 | 3004677695 | Bacteroides sp. 214 | Isolate | Blattidae |
| 38 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 39 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 40 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 41 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 42 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 43 | 2761201709 | Ogataea arabinofermentans NRRL YB-2248 | Isolate | Unclassified |
| 44 | 2825804107 | Enterococcus durans BDGP3 | Isolate | Drosophilidae |
| 45 | 2864909992 | Bacillus velezensis S00166 | Isolate | Elmidae |
| 46 | 2873610414 | Dysgonomonas sp. HDW5B | Isolate | Hydrophilidae |
| 47 | 2894649344 | Allomuricauda alvinocaridis SCR12 | Isolate | Unclassified |
| 48 | 2940199050 | Parabacteroides sp. PM6-13 | Isolate | Blattidae |
| 49 | 2940202316 | Parabacteroides sp. PF5-9 | Isolate | Blattidae |
| 50 | 2940371297 | Parabacteroides sp. PM5-20 | Isolate | Blattidae |
| 51 | 3300002507 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 | Metagenome | Termitidae |
| 52 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 53 | 3300007149 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 4 gut | Metagenome | Drosophilidae |
| 54 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 55 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 56 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 57 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 58 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 59 | 8018794549 | Enterococcus sp. 6D12_DIV0197 6D12_DIV0197 | Isolate | |
| 60 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 61 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 62 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 63 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 64 | 2695420931 | Dysgonomonas macrotermitis DSM 27370 | Isolate | Unclassified |
| 65 | 2718218155 | Flavobacteriaceae bacterium UJ101 | Isolate | |
| 66 | 2775507073 | Enterococcus sp. CR-Ec1 | Isolate | Unclassified |
| 67 | 2820037192 | Unclassified Saccharibacteria Nc150P3bin23 | Isolate | Unclassified |
| 68 | 2864836148 | Arcicella rosea S00070 | Isolate | Elmidae |
| 69 | 2940205530 | Parabacteroides sp. PH5-33 | Isolate | Blattidae |
| 70 | 2940317558 | Parabacteroides sp. PH5-26 | Isolate | Blattidae |
| 71 | 2940325180 | Parabacteroides sp. PH5-41 | Isolate | Blattidae |
| 72 | 2998929858 | Bacteroidetes endosymbiont of Geopemphigus sp. GspS2-BC2016 | Isolate | Aphididae |
| 73 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 74 | 2576861701 | Paenibacillus sp. JCM 10914 | Isolate | Termitidae |
| 75 | 2622736579 | Desemzia incerta DSM 20581 | Isolate | Unclassified |
| 76 | 2820110010 | Unclassified Proteobacteria Emb289P4bin35 | Isolate | Unclassified |
| 77 | 2820036294 | Unclassified Saccharibacteria Nc150P4bin6 | Isolate | Unclassified |
| 78 | 2820572885 | Unclassified Firmicutes Emb289P3bin161 | Isolate | Unclassified |
| 79 | 2910926975 | Dysgonomonas sp. 25 | Isolate | Blattidae |
| 80 | 2940195863 | Parabacteroides sp. PF5-6 | Isolate | Blattidae |
| 81 | 2940209341 | Parabacteroides sp. PFB2-10 | Isolate | Blattidae |
| 82 | 2940261461 | Enterococcus sp. PFB1-1 | Isolate | Blattidae |
| 83 | 2940298504 | Parabacteroides sp. PF5-13 | Isolate | Blattidae |
| 84 | 2940336608 | Dysgonomonas sp. PH5-37 | Isolate | Blattidae |
| 85 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 86 | 3300026175 | Army ant gut microbial communities from Eciton burchelli, Monteverde, Costa Rica - colony MVEbp1 | Metagenome | Formicidae |
| 87 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 88 | 8002519755 | Planococcus sp. MSAK28401 | Isolate | Euphausiidae |
| 89 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 90 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 91 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 92 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 93 | 2609459943 | Bacteroides reticulotermitis JCM 10512 | Isolate | Rhinotermitidae |
| 94 | 2820353569 | Unclassified Firmicutes Nt197P3bin28 | Isolate | Unclassified |
| 95 | 2820776227 | Unclassified Bacteroidetes Emb289P4bin3 | Isolate | Unclassified |
| 96 | 2821312900 | Unclassified Proteobacteria Lab288P4bin16 | Isolate | Unclassified |
| 97 | 2873584433 | Vagococcus coleopterorum HDW17A | Isolate | Dytiscidae |
| 98 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 99 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 100 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 101 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 102 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 103 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 104 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 105 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 106 | 2852431164 | Brevibacillus laterosporus BON707 | Isolate | Calliphoridae |
| 107 | 2881375749 | Vagococcus entomophilus DSM 24756 | Isolate | Vespidae |
| 108 | 2910959314 | Dysgonomonas sp. 511 | Isolate | Blattidae |
| 109 | 2923982719 | Parabacteroides sp. 52 | Isolate | Blattidae |
| 110 | 2940218408 | Enterococcus sp. PF1-24 | Isolate | Blattidae |
| 111 | 2940306115 | Parabacteroides sp. PFB2-22 | Isolate | Blattidae |
| 112 | 2940309933 | Parabacteroides sp. PH5-13 | Isolate | Blattidae |
| 113 | 2940328985 | Parabacteroides sp. PH5-46 | Isolate | Blattidae |
| 114 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 115 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 116 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 117 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 118 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 119 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 120 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 121 | 3300056814 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) | Metagenome | Tenebrionidae |
| 122 | 3300057007 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) | Metagenome | Tenebrionidae |
| 123 | 8100157865 | Dysgonomonas sp. GY617 | Isolate | Rhinotermitidae |
| 124 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 125 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 126 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 127 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 128 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_178310 | 3300042612 | Bacteria | 21387 |
| 2 | Ga0466705_284863 | 3300042612 | Bacteria | 5252 |
| 3 | Ga0466733_115090 | 3300042659 | Bacteria | 36203 |
| 4 | Ga0562375_0204 | 3300056856 | Bacteria | 167226 |
| 5 | Ga0466710_415727 | 3300042613 | Bacteria | 1102 |
| 6 | Ga0466711_128750 | 3300042615 | Bacteria | 25962 |
| 7 | Ga0466711_243981 | 3300042615 | Bacteria | 41601 |
| 8 | Ga0466711_389119 | 3300042615 | Bacteria | 6281 |
| 9 | Ga0466711_407666 | 3300042615 | Bacteria | 14536 |
| 10 | Ga0466715_231847 | 3300042616 | Bacteria | 6555 |
| 11 | Ga0466715_242567 | 3300042616 | Bacteria | 7660 |
| 12 | Ga0466715_357160 | 3300042616 | Bacteria | 4956 |
| 13 | Ga0466723_053014 | 3300042618 | Bacteria | 3762 |
| 14 | Ga0466726_323959 | 3300042619 | Bacteria | 1550 |
| 15 | Ga0255572_1000093 | 3300026175 | Bacteria | 73678 |
| 16 | Ga0466656_127101 | 3300042550 | Bacteria | 8038 |
| 17 | Ga0466691_153448 | 3300042593 | Unclassified | 2275 |
| 18 | Ga0466696_497799 | 3300042596 | Bacteria | 4122 |
| 19 | Ga0466703_328058 | 3300042636 | Bacteria | 1014 |
| 20 | Ga0466704_117281 | 3300042643 | Bacteria | 9848 |
| 21 | Ga0466704_150843 | 3300042643 | Bacteria | 5194 |
| 22 | Ga0466704_228263 | 3300042643 | Bacteria | 1442 |
| 23 | Ga0466704_419440 | 3300042643 | Bacteria | 29962 |
| 24 | Ga0466727_106196 | 3300042655 | Bacteria | 6640 |
| 25 | Ga0466727_111084 | 3300042655 | Bacteria | 1544 |
| 26 | Ga0123357_10087845 | 3300009784 | Bacteria | 4066 |
| 27 | Ga0123356_10219388 | 3300010049 | Unclassified | 1957 |
| 28 | Ga0123353_10079749 | 3300010167 | Bacteria | 5264 |
| 29 | Ga0123353_10380322 | 3300010167 | Unclassified | 2112 |
| 30 | Ga0123353_10552790 | 3300010167 | Bacteria | 1660 |
| 31 | Ga0123354_10222738 | 3300010882 | Bacteria | 1998 |
| 32 | Ga0466706_159783 | 3300042599 | Bacteria | 2925 |
| 33 | Ga0466706_178660 | 3300042599 | Bacteria | 2739 |
| 34 | Ga0466706_183663 | 3300042599 | Bacteria | 10323 |
| 35 | Ga0466700_233578 | 3300042600 | Bacteria | 2533 |
| 36 | Ga0466707_380820 | 3300042601 | Bacteria | 2537 |
| 37 | Ga0466714_149003 | 3300042603 | Bacteria | 5399 |
| 38 | Ga0466716_131077 | 3300042605 | Bacteria | 9033 |
| 39 | Ga0466719_574895 | 3300042606 | Bacteria | 2067 |
| 40 | Ga0466722_088955 | 3300042609 | Bacteria | 6549 |
| 41 | IMNBL1DRAFT_c0018579 | 3300000062 | Bacteria | 2885 |
| 42 | Ga0466733_045667 | 3300042659 | Bacteria | 5056 |
| 43 | Ga0466733_146244 | 3300042659 | Bacteria | 18136 |
| 44 | Ga0466733_153801 | 3300042659 | Bacteria | 58972 |
| 45 | Ga0562379_0429 | 3300056790 | Bacteria | 90757 |
| 46 | Ga0562374_0925 | 3300057007 | Bacteria | 40344 |
| 47 | Ga0466710_147963 | 3300042613 | Bacteria | 1128 |
| 48 | Ga0466711_353104 | 3300042615 | Bacteria | 7302 |
| 49 | Ga0466726_267442 | 3300042619 | Bacteria | 2929 |
| 50 | Ga0466728_086099 | 3300042620 | Bacteria | 10771 |
| 51 | Ga0466729_070787 | 3300042621 | Bacteria | 29335 |
| 52 | Ga0466690_114199 | 3300042590 | Bacteria | 18998 |
| 53 | Ga0466690_130601 | 3300042590 | Bacteria | 9968 |
| 54 | Ga0466690_238834 | 3300042590 | Bacteria | 6175 |
| 55 | Ga0466693_259666 | 3300042592 | Bacteria | 1146 |
| 56 | Ga0466696_084546 | 3300042596 | Bacteria | 3886 |
| 57 | Ga0466735_060943 | 3300042624 | Bacteria | 1422 |
| 58 | Ga0466702_144741 | 3300042635 | Bacteria | 2195 |
| 59 | Ga0466702_244404 | 3300042635 | Bacteria | 50690 |
| 60 | Ga0466709_194131 | 3300042648 | Bacteria | 3721 |
| 61 | Ga0466727_127814 | 3300042655 | Bacteria | 2812 |
| 62 | Ga0123357_10321416 | 3300009784 | Bacteria | 1528 |
| 63 | Ga0123356_10205630 | 3300010049 | Bacteria | 2012 |
| 64 | Ga0123356_10629125 | 3300010049 | Bacteria | 1239 |
| 65 | Ga0123353_10187746 | 3300010167 | Bacteria | 3266 |
| 66 | Ga0466706_179014 | 3300042599 | Bacteria | 61419 |
| 67 | Ga0466707_127369 | 3300042601 | Bacteria | 23245 |
| 68 | Ga0466713_104757 | 3300042602 | Bacteria | 74823 |
| 69 | Ga0466713_145528 | 3300042602 | Bacteria | 11874 |
| 70 | 2227488529 | 2225789004 | Bacteria | 20883 |
| 71 | 2227504625 | 2225789004 | Bacteria | 3714 |
| 72 | Ga0104045_1007863 | 3300007085 | Bacteria | 1428 |
| 73 | Ga0104040_1151533 | 3300007149 | Bacteria | 1157 |
| 74 | Ga0127649_101685 | 3300009460 | Bacteria | 17684 |
| 75 | Ga0466705_279913 | 3300042612 | Bacteria | 3374 |
| 76 | Ga0466727_349518 | 3300042655 | Bacteria | 5868 |
| 77 | Ga0466733_012100 | 3300042659 | Bacteria | 29442 |
| 78 | Ga0466733_074439 | 3300042659 | Bacteria | 10531 |
| 79 | Ga0562377_0079 | 3300056842 | Bacteria | 368723 |
| 80 | Ga0562374_0010 | 3300057007 | Bacteria | 1930599 |
| 81 | Ga0466711_006852 | 3300042615 | Bacteria | 65097 |
| 82 | Ga0466711_057572 | 3300042615 | Bacteria | 11211 |
| 83 | Ga0466711_096764 | 3300042615 | Bacteria | 23270 |
| 84 | Ga0466691_015234 | 3300042593 | Bacteria | 46974 |
| 85 | Ga0466694_315371 | 3300042594 | Bacteria | 6658 |
| 86 | Ga0466735_173017 | 3300042624 | Bacteria | 3448 |
| 87 | Ga0466704_437416 | 3300042643 | Bacteria | 7666 |
| 88 | Ga0466709_190200 | 3300042648 | Bacteria | 25612 |
| 89 | Ga0466708_056525 | 3300042652 | Bacteria | 81892 |
| 90 | Ga0466725_021431 | 3300042654 | Bacteria | 9647 |
| 91 | Ga0466727_283124 | 3300042655 | Bacteria | 11956 |
| 92 | Ga0123356_10003992 | 3300010049 | Bacteria | 15326 |
| 93 | Ga0123356_10023624 | 3300010049 | Unclassified | 5784 |
| 94 | Ga0123356_10828057 | 3300010049 | Bacteria | 1097 |
| 95 | Ga0123353_10190846 | 3300010167 | Bacteria | 3234 |
| 96 | Ga0123353_11371565 | 3300010167 | Bacteria | 911 |
| 97 | Ga0466700_036994 | 3300042600 | Bacteria | 1037 |
| 98 | Ga0466707_044741 | 3300042601 | Bacteria | 10694 |
| 99 | Ga0466707_117848 | 3300042601 | Bacteria | 2208 |
| 100 | Ga0466713_013709 | 3300042602 | Bacteria | 106354 |
| 101 | Ga0466713_014680 | 3300042602 | Bacteria | 48276 |
| 102 | Ga0466717_085874 | 3300042604 | Bacteria | 1264 |
| 103 | Ga0466717_133575 | 3300042604 | Bacteria | 2998 |
| 104 | Ga0466717_288935 | 3300042604 | Bacteria | 1160 |
| 105 | Ga0466716_078053 | 3300042605 | Bacteria | 17042 |
| 106 | Ga0466716_109841 | 3300042605 | Bacteria | 1438 |
| 107 | AustNasuHG_c1000085 | 3300000089 | Bacteria | 26834 |
| 108 | JGI24702J35022_10016872 | 3300002462 | Bacteria | 3998 |
| 109 | Ga0068302_10521730 | 3300005071 | Bacteria | 1086 |
| 110 | Ga0072940_1036327 | 3300005200 | Bacteria | 2798 |
| 111 | Ga0072941_1021068 | 3300005201 | Bacteria | 99237 |
| 112 | Ga0466705_131104 | 3300042612 | Bacteria | 34291 |
| 113 | Ga0466705_255466 | 3300042612 | Bacteria | 19691 |
| 114 | Ga0562374_0015 | 3300057007 | Bacteria | 1219565 |
| 115 | Ga0466715_603434 | 3300042616 | Bacteria | 6616 |
| 116 | Ga0466690_224751 | 3300042590 | Bacteria | 8006 |
| 117 | Ga0466692_193814 | 3300042591 | Bacteria | 23056 |
| 118 | Ga0466693_163285 | 3300042592 | Bacteria | 1631 |
| 119 | Ga0466693_181669 | 3300042592 | Bacteria | 1712 |
| 120 | Ga0466735_129012 | 3300042624 | Bacteria | 1932 |
| 121 | Ga0466703_289947 | 3300042636 | Bacteria | 14348 |
| 122 | Ga0466704_186702 | 3300042643 | Bacteria | 6760 |
| 123 | Ga0466704_198980 | 3300042643 | Bacteria | 9267 |
| 124 | Ga0466709_008153 | 3300042648 | Bacteria | 16735 |
| 125 | Ga0466709_298019 | 3300042648 | Bacteria | 16242 |
| 126 | Ga0466708_016632 | 3300042652 | Bacteria | 33440 |
| 127 | Ga0466727_042054 | 3300042655 | Bacteria | 1202 |
| 128 | Ga0466727_304931 | 3300042655 | Bacteria | 1729 |
| 129 | Ga0123357_10174916 | 3300009784 | Bacteria | 2527 |
| 130 | Ga0123355_10558771 | 3300009826 | Bacteria | 1380 |
| 131 | Ga0123356_10109735 | 3300010049 | Bacteria | 2663 |
| 132 | Ga0123353_10551220 | 3300010167 | Bacteria | 1663 |
| 133 | Ga0466707_094167 | 3300042601 | Bacteria | 1033 |
| 134 | Ga0466707_312260 | 3300042601 | Bacteria | 5317 |
| 135 | Ga0466707_344103 | 3300042601 | Bacteria | 12432 |
| 136 | Ga0466713_016019 | 3300042602 | Bacteria | 439221 |
| 137 | Ga0466713_078115 | 3300042602 | Bacteria | 19253 |
| 138 | Ga0466713_136156 | 3300042602 | Bacteria | 13600 |
| 139 | Ga0466716_383284 | 3300042605 | Bacteria | 5779 |
| 140 | Ga0466722_124245 | 3300042609 | Bacteria | 6247 |
| 141 | 2227153039 | 2225789004 | Bacteria | 8488 |
| 142 | Ga0123357_10000861 | 3300009784 | Bacteria | 30918 |
| 143 | Ga0466705_359127 | 3300042612 | Bacteria | 4845 |
| 144 | Ga0466733_088004 | 3300042659 | Bacteria | 203974 |
| 145 | Ga0466733_089980 | 3300042659 | Bacteria | 4721 |
| 146 | Ga0466711_141138 | 3300042615 | Bacteria | 2034 |
| 147 | Ga0466711_179941 | 3300042615 | Bacteria | 1732 |
| 148 | Ga0466711_396839 | 3300042615 | Bacteria | 15756 |
| 149 | Ga0466723_336464 | 3300042618 | Bacteria | 1151 |
| 150 | Ga0466728_006052 | 3300042620 | Bacteria | 1076 |
| 151 | Ga0466728_015608 | 3300042620 | Bacteria | 1005 |
| 152 | Ga0466728_042362 | 3300042620 | Bacteria | 23121 |
| 153 | Ga0466692_165599 | 3300042591 | Bacteria | 54055 |
| 154 | Ga0466691_034570 | 3300042593 | Bacteria | 25425 |
| 155 | Ga0466696_090541 | 3300042596 | Bacteria | 6023 |
| 156 | Ga0466696_132579 | 3300042596 | Bacteria | 5493 |
| 157 | Ga0466696_246940 | 3300042596 | Bacteria | 2435 |
| 158 | Ga0466735_108841 | 3300042624 | Bacteria | 1511 |
| 159 | Ga0466730_038050 | 3300042625 | Unclassified | 3447 |
| 160 | Ga0466703_180950 | 3300042636 | Bacteria | 1910 |
| 161 | Ga0466704_155344 | 3300042643 | Bacteria | 13326 |
| 162 | Ga0466704_187831 | 3300042643 | Bacteria | 2517 |
| 163 | Ga0466704_277144 | 3300042643 | Bacteria | 3284 |
| 164 | Ga0466704_366092 | 3300042643 | Bacteria | 11039 |
| 165 | Ga0466704_507606 | 3300042643 | Bacteria | 29956 |
| 166 | Ga0466727_238759 | 3300042655 | Bacteria | 22004 |
| 167 | Ga0123355_10687686 | 3300009826 | Bacteria | 1179 |
| 168 | Ga0123353_10046652 | 3300010167 | Bacteria | 6888 |
| 169 | Ga0466706_017666 | 3300042599 | Bacteria | 79223 |
| 170 | Ga0466706_123047 | 3300042599 | Bacteria | 432554 |
| 171 | Ga0466716_224352 | 3300042605 | Bacteria | 10306 |
| 172 | Ga0466719_224762 | 3300042606 | Bacteria | 9692 |
| 173 | Ga0466722_011550 | 3300042609 | Bacteria | 16044 |
| 174 | IMNBL1DRAFT_c0003788 | 3300000062 | Bacteria | 9447 |
| 175 | JGI24702J35022_10017895 | 3300002462 | Bacteria | 3869 |
| 176 | JGI24702J35022_10058013 | 3300002462 | Unclassified | 2067 |
| 177 | Ga0466705_281178 | 3300042612 | Bacteria | 2203 |
| 178 | Ga0466733_179584 | 3300042659 | Bacteria | 84251 |
| 179 | Ga0562377_0317 | 3300056842 | Bacteria | 97339 |
| 180 | Ga0466711_183949 | 3300042615 | Bacteria | 1065 |
| 181 | Ga0466715_030319 | 3300042616 | Bacteria | 43703 |
| 182 | Ga0466715_321661 | 3300042616 | Bacteria | 3486 |
| 183 | Ga0466718_063147 | 3300042617 | Bacteria | 2861 |
| 184 | Ga0466723_090119 | 3300042618 | Bacteria | 15457 |
| 185 | Ga0466726_082119 | 3300042619 | Bacteria | 15276 |
| 186 | Ga0466726_318837 | 3300042619 | Bacteria | 4471 |
| 187 | Ga0466690_174546 | 3300042590 | Bacteria | 4548 |
| 188 | Ga0466690_386284 | 3300042590 | Bacteria | 1695 |
| 189 | Ga0466693_243680 | 3300042592 | Bacteria | 4764 |
| 190 | Ga0466691_080352 | 3300042593 | Bacteria | 30374 |
| 191 | Ga0466691_083535 | 3300042593 | Bacteria | 5757 |
| 192 | Ga0466696_021132 | 3300042596 | Bacteria | 14935 |
| 193 | Ga0466696_197443 | 3300042596 | Bacteria | 1692 |
| 194 | Ga0466696_245154 | 3300042596 | Bacteria | 5063 |
| 195 | Ga0466696_269250 | 3300042596 | Bacteria | 19487 |
| 196 | Ga0466735_008575 | 3300042624 | Bacteria | 2686 |
| 197 | Ga0466735_136560 | 3300042624 | Bacteria | 1005 |
| 198 | Ga0466735_233040 | 3300042624 | Bacteria | 2091 |
| 199 | Ga0466703_230934 | 3300042636 | Bacteria | 31793 |
| 200 | Ga0466703_256308 | 3300042636 | Bacteria | 9873 |
| 201 | Ga0466703_311082 | 3300042636 | Bacteria | 8263 |
| 202 | Ga0466704_100291 | 3300042643 | Bacteria | 27866 |
| 203 | Ga0466708_151171 | 3300042652 | Bacteria | 22792 |
| 204 | Ga0466727_140759 | 3300042655 | Bacteria | 3759 |
| 205 | Ga0466727_298156 | 3300042655 | Bacteria | 3762 |
| 206 | Ga0123357_10015305 | 3300009784 | Bacteria | 10054 |
| 207 | Ga0123355_10033166 | 3300009826 | Bacteria | 8386 |
| 208 | Ga0123356_10864607 | 3300010049 | Bacteria | 1075 |
| 209 | Ga0123356_10954722 | 3300010049 | Bacteria | 1028 |
| 210 | Ga0123353_10553034 | 3300010167 | Bacteria | 1659 |
| 211 | Ga0123353_10793326 | 3300010167 | Bacteria | 1309 |
| 212 | Ga0123353_11168277 | 3300010167 | Bacteria | 1014 |
| 213 | Ga0123354_10562123 | 3300010882 | Bacteria | 854 |
| 214 | Ga0466706_066943 | 3300042599 | Bacteria | 7526 |
| 215 | Ga0466706_282332 | 3300042599 | Bacteria | 32021 |
| 216 | Ga0466707_276149 | 3300042601 | Bacteria | 1308 |
| 217 | Ga0466713_061808 | 3300042602 | Bacteria | 6780 |
| 218 | Ga0466713_118729 | 3300042602 | Bacteria | 43969 |
| 219 | Ga0466714_103553 | 3300042603 | Bacteria | 16883 |
| 220 | Ga0466719_006809 | 3300042606 | Bacteria | 24772 |
| 221 | Ga0466719_008090 | 3300042606 | Bacteria | 7369 |
| 222 | Ga0466719_502905 | 3300042606 | Bacteria | 2081 |
| 223 | Ga0466719_530151 | 3300042606 | Bacteria | 9750 |
| 224 | Ga0466697_055467 | 3300042611 | Bacteria | 1448 |
| 225 | 2227430794 | 2225789004 | Bacteria | 5570 |
| 226 | JGI24702J35022_10020612 | 3300002462 | Bacteria | 3577 |
| 227 | Ga0466697_120508 | 3300042611 | Bacteria | 1339 |
| 228 | Ga0466697_206730 | 3300042611 | Bacteria | 3378 |
| 229 | Ga0562378_0263 | 3300056814 | Bacteria | 119760 |
| 230 | Ga0466715_113102 | 3300042616 | Bacteria | 17320 |
| 231 | Ga0466715_240008 | 3300042616 | Bacteria | 2726 |
| 232 | Ga0466723_025239 | 3300042618 | Bacteria | 67003 |
| 233 | Ga0466723_180994 | 3300042618 | Bacteria | 6275 |
| 234 | Ga0466726_112547 | 3300042619 | Bacteria | 5322 |
| 235 | Ga0466690_021160 | 3300042590 | Bacteria | 34990 |
| 236 | Ga0466693_112691 | 3300042592 | Bacteria | 1410 |
| 237 | Ga0466693_440070 | 3300042592 | Bacteria | 6543 |
| 238 | Ga0466734_165860 | 3300042623 | Bacteria | 1498 |
| 239 | Ga0466703_048827 | 3300042636 | Bacteria | 2107 |
| 240 | Ga0466704_443120 | 3300042643 | Bacteria | 1266 |
| 241 | Ga0466704_557353 | 3300042643 | Bacteria | 2055 |
| 242 | Ga0466709_068776 | 3300042648 | Bacteria | 148378 |
| 243 | Ga0466709_324327 | 3300042648 | Bacteria | 94808 |
| 244 | Ga0466725_122042 | 3300042654 | Bacteria | 22918 |
| 245 | Ga0466727_163352 | 3300042655 | Bacteria | 6809 |
| 246 | Ga0123356_10024502 | 3300010049 | Bacteria | 5676 |
| 247 | Ga0123356_10080753 | 3300010049 | Bacteria | 3075 |
| 248 | Ga0123356_10275220 | 3300010049 | Bacteria | 1775 |
| 249 | Ga0123353_10346811 | 3300010167 | Bacteria | 2240 |
| 250 | Ga0123353_10587719 | 3300010167 | Bacteria | 1595 |
| 251 | Ga0466706_202163 | 3300042599 | Bacteria | 24863 |
| 252 | Ga0466706_289054 | 3300042599 | Bacteria | 1180 |
| 253 | Ga0466716_034808 | 3300042605 | Bacteria | 61138 |
| 254 | Ga0466722_159681 | 3300042609 | Bacteria | 66135 |
| 255 | Ga0466722_190554 | 3300042609 | Bacteria | 18850 |
| 256 | Ga0466722_259539 | 3300042609 | Bacteria | 15530 |
| 257 | Ga0466698_177829 | 3300042610 | Bacteria | 2357 |
| 258 | JGI24702J35022_10166426 | 3300002462 | Bacteria | 1245 |
| 259 | JGI24697J35500_11218894 | 3300002507 | Bacteria | 1859 |
| 260 | JGI24696J40584_12949817 | 3300002834 | Bacteria | 2102 |
| 261 | Ga0068305_10002946 | 3300005083 | Bacteria | 63588 |
| 262 | Ga0068305_10005116 | 3300005083 | Bacteria | 49058 |
| 263 | Ga0068305_10017229 | 3300005083 | Bacteria | 31069 |
| 264 | Ga0068305_10100573 | 3300005083 | Bacteria | 12018 |
| 265 | Ga0068305_10210201 | 3300005083 | Bacteria | 1359 |
| 266 | Ga0072941_1198671 | 3300005201 | Bacteria | 2862 |
| 267 | Ga0466697_079915 | 3300042611 | Bacteria | 1404 |
| 268 | Ga0466705_100804 | 3300042612 | Bacteria | 3024 |
| 269 | Ga0466733_074234 | 3300042659 | Bacteria | 1458 |
| 270 | Ga0562374_0007 | 3300057007 | Bacteria | 2074405 |
| 271 | Ga0466715_126491 | 3300042616 | Bacteria | 23140 |
| 272 | Ga0466723_053725 | 3300042618 | Bacteria | 10277 |
| 273 | Ga0466728_106547 | 3300042620 | Bacteria | 16381 |
| 274 | Ga0466729_224585 | 3300042621 | Bacteria | 10662 |
| 275 | Ga0466735_000247 | 3300042624 | Bacteria | 2649 |
| 276 | Ga0466702_014445 | 3300042635 | Bacteria | 10885 |
| 277 | Ga0466703_266977 | 3300042636 | Unclassified | 17396 |
| 278 | Ga0466703_291075 | 3300042636 | Bacteria | 2877 |
| 279 | Ga0466704_064263 | 3300042643 | Bacteria | 11580 |
| 280 | Ga0466704_367037 | 3300042643 | Bacteria | 4445 |
| 281 | Ga0466709_169723 | 3300042648 | Bacteria | 216757 |
| 282 | Ga0466709_257118 | 3300042648 | Bacteria | 3021 |
| 283 | Ga0123357_10025686 | 3300009784 | Bacteria | 7949 |
| 284 | Ga0123355_10003806 | 3300009826 | Bacteria | 21816 |
| 285 | Ga0123355_10028651 | 3300009826 | Bacteria | 9006 |
| 286 | Ga0123353_10875432 | 3300010167 | Bacteria | 1227 |
| 287 | Ga0466706_076986 | 3300042599 | Bacteria | 1676 |
| 288 | Ga0466706_174058 | 3300042599 | Bacteria | 1950 |
| 289 | Ga0466706_227285 | 3300042599 | Bacteria | 1148 |
| 290 | Ga0466707_169804 | 3300042601 | Bacteria | 25135 |
| 291 | Ga0466713_081547 | 3300042602 | Bacteria | 50254 |
| 292 | Ga0466713_082875 | 3300042602 | Bacteria | 12823 |
| 293 | Ga0466713_098018 | 3300042602 | Bacteria | 5633 |
| 294 | Ga0466722_251436 | 3300042609 | Bacteria | 4007 |
| 295 | JGI24702J35022_10000154 | 3300002462 | Bacteria | 35545 |
| 296 | JGI24702J35022_10025785 | 3300002462 | Bacteria | 3169 |
| 297 | JGI24705J35276_12237882 | 3300002504 | Bacteria | 13818 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF03167 | UDG | Uracil DNA glycosylase superfamily | 94 | 253 | 0.79 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.