Protein Family IF05724
Metagenome
Isolate
152
Members
53
Samples
150
Scaffolds
261.08
Avg Length
Representative Sequence
- ID
- 3300042600|Ga0466700_151968|Ga0466700_151968_773_1561
- Length
- 262 aa
- Sequence
- MIPLAAITEWSNVSPWTNTHFVEQDLLICRVLTDLFNDKTLAEKLAFRGGTALHKLYLHPQQRYSEDIDFVQTNPEPIGFVLNRIREVLSYIGAPTIKQKQKNNTVVYRFHTEALPQAVMRLKIEINCQEHLSVQGLQKIPFEVNNSWFTGNCDIVTYTFDELIATKIRALYQRKKGRDLFDIYQALNSGKLDIEKTIFCYKKYMEQSAAQIPSARQYLDNLQSKMNNQIFCSDMEPLLRPGAGYGIHAAYEAFHKHFISVM
Sample Types
Isolate
1.3%
Metagenome
98.7%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
49.0%
Kalotermitidae
27.5%
Rhinotermitidae
7.8%
Termopsidae
5.9%
Unclassified
5.9%
Hodotermitidae
2.0%
Passalidae
2.0%
Taxonomy
Archaea
0
Bacteria
125
Eukaryota
0
Viruses
0
Unclassified
27
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 2 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 3 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 4 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 5 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 6 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 7 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 8 | 8100157865 | Dysgonomonas sp. GY617 | Isolate | Rhinotermitidae |
| 9 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 10 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 11 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 12 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 13 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 14 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 15 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 16 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 17 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 18 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 19 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 20 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 21 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 22 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 23 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 24 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 25 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 26 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 27 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 28 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 29 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 30 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 31 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 32 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 33 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 34 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 35 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 36 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 37 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 38 | 2820778767 | Unclassified Bacteroidetes Emb289P4bin10 | Isolate | Unclassified |
| 39 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 40 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 41 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 42 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 43 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 44 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 45 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 46 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 47 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 48 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 49 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 50 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 51 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 52 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 53 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_042001 | 3300042612 | Bacteria | 2177 |
| 2 | Ga0466705_090578 | 3300042612 | Bacteria | 2133 |
| 3 | Ga0466705_226038 | 3300042612 | Bacteria | 8838 |
| 4 | Ga0466657_145615 | 3300042582 | Bacteria | 4272 |
| 5 | Ga0466696_164407 | 3300042596 | Bacteria | 8262 |
| 6 | Ga0466707_361113 | 3300042601 | Bacteria | 15284 |
| 7 | Ga0072941_1160723 | 3300005201 | Unclassified | 1097 |
| 8 | Ga0072941_1361054 | 3300005201 | Bacteria | 2041 |
| 9 | Ga0123354_10204705 | 3300010882 | Bacteria | 2155 |
| 10 | Ga0123354_10219760 | 3300010882 | Bacteria | 2023 |
| 11 | Ga0123354_10357010 | 3300010882 | Bacteria | 1294 |
| 12 | Ga0466711_240999 | 3300042615 | Bacteria | 6354 |
| 13 | Ga0466723_117184 | 3300042618 | Bacteria | 2162 |
| 14 | Ga0466735_031848 | 3300042624 | Bacteria | 3054 |
| 15 | Ga0466703_233720 | 3300042636 | Unclassified | 2709 |
| 16 | Ga0466703_398508 | 3300042636 | Unclassified | 2918 |
| 17 | Ga0466733_093532 | 3300042659 | Bacteria | 1839 |
| 18 | Ga0466690_035019 | 3300042590 | Bacteria | 3982 |
| 19 | Ga0466691_097988 | 3300042593 | Bacteria | 31039 |
| 20 | Ga0466694_050610 | 3300042594 | Bacteria | 1494 |
| 21 | Ga0466694_271062 | 3300042594 | Bacteria | 2470 |
| 22 | Ga0466696_276521 | 3300042596 | Unclassified | 1102 |
| 23 | Ga0466713_084862 | 3300042602 | Bacteria | 3250 |
| 24 | Ga0466719_029224 | 3300042606 | Bacteria | 10040 |
| 25 | IMNBL1DRAFT_c0015016 | 3300000062 | Bacteria | 3380 |
| 26 | Ga0123357_10001648 | 3300009784 | Bacteria | 23972 |
| 27 | Ga0123353_10009770 | 3300010167 | Unclassified | 13291 |
| 28 | Ga0466705_445849 | 3300042612 | Unclassified | 2565 |
| 29 | Ga0466711_094184 | 3300042615 | Bacteria | 20319 |
| 30 | Ga0466711_268272 | 3300042615 | Unclassified | 1781 |
| 31 | Ga0466723_268807 | 3300042618 | Bacteria | 43614 |
| 32 | Ga0466726_246826 | 3300042619 | Bacteria | 2183 |
| 33 | Ga0466728_186596 | 3300042620 | Bacteria | 2010 |
| 34 | Ga0466703_205766 | 3300042636 | Bacteria | 18549 |
| 35 | Ga0466704_064771 | 3300042643 | Unclassified | 2054 |
| 36 | Ga0466709_046018 | 3300042648 | Bacteria | 14812 |
| 37 | Ga0466709_051680 | 3300042648 | Bacteria | 2571 |
| 38 | Ga0466727_309483 | 3300042655 | Bacteria | 2256 |
| 39 | Ga0466691_026620 | 3300042593 | Bacteria | 13614 |
| 40 | Ga0466694_339110 | 3300042594 | Bacteria | 1522 |
| 41 | Ga0466707_203362 | 3300042601 | Bacteria | 7782 |
| 42 | Ga0466714_042875 | 3300042603 | Bacteria | 1752 |
| 43 | IMNBL1DRAFT_c0061501 | 3300000062 | Bacteria | 1126 |
| 44 | Ga0072940_1477159 | 3300005200 | Bacteria | 985 |
| 45 | Ga0072941_1119639 | 3300005201 | Bacteria | 1976 |
| 46 | Ga0123357_10063634 | 3300009784 | Unclassified | 4933 |
| 47 | Ga0466710_233864 | 3300042613 | Unclassified | 1066 |
| 48 | Ga0466702_091649 | 3300042635 | Bacteria | 2217 |
| 49 | Ga0466702_366304 | 3300042635 | Bacteria | 2102 |
| 50 | Ga0466704_046917 | 3300042643 | Unclassified | 11002 |
| 51 | Ga0466709_180033 | 3300042648 | Bacteria | 1951 |
| 52 | Ga0466657_015830 | 3300042582 | Unclassified | 1155 |
| 53 | Ga0466690_204873 | 3300042590 | Bacteria | 1111 |
| 54 | Ga0466693_366838 | 3300042592 | Unclassified | 1104 |
| 55 | Ga0466706_067347 | 3300042599 | Bacteria | 16310 |
| 56 | Ga0466707_008156 | 3300042601 | Bacteria | 2918 |
| 57 | Ga0466719_565098 | 3300042606 | Bacteria | 14894 |
| 58 | Ga0466722_113951 | 3300042609 | Bacteria | 3398 |
| 59 | JGI24702J35022_10045284 | 3300002462 | Bacteria | 2344 |
| 60 | JGI24705J35276_12188433 | 3300002504 | Bacteria | 1441 |
| 61 | Ga0466710_411882 | 3300042613 | Bacteria | 1378 |
| 62 | Ga0466728_009850 | 3300042620 | Bacteria | 2901 |
| 63 | Ga0466729_244538 | 3300042621 | Bacteria | 9713 |
| 64 | Ga0466703_201014 | 3300042636 | Unclassified | 1874 |
| 65 | Ga0466704_307615 | 3300042643 | Unclassified | 8607 |
| 66 | Ga0466709_169180 | 3300042648 | Bacteria | 45156 |
| 67 | Ga0466694_043021 | 3300042594 | Bacteria | 1983 |
| 68 | Ga0466699_039741 | 3300042597 | Bacteria | 3591 |
| 69 | Ga0466706_030038 | 3300042599 | Bacteria | 3552 |
| 70 | Ga0466707_062229 | 3300042601 | Unclassified | 5870 |
| 71 | Ga0466707_379065 | 3300042601 | Bacteria | 7175 |
| 72 | Ga0466716_142279 | 3300042605 | Bacteria | 3268 |
| 73 | Ga0123353_10000035 | 3300010167 | Bacteria | 147488 |
| 74 | Ga0123354_10000978 | 3300010882 | Unclassified | 32424 |
| 75 | Ga0123354_10001198 | 3300010882 | Bacteria | 30564 |
| 76 | Ga0466711_036432 | 3300042615 | Bacteria | 7039 |
| 77 | Ga0466711_298434 | 3300042615 | Unclassified | 1418 |
| 78 | Ga0466715_187301 | 3300042616 | Bacteria | 2156 |
| 79 | Ga0466734_162861 | 3300042623 | Bacteria | 1037 |
| 80 | Ga0466734_173765 | 3300042623 | Bacteria | 1040 |
| 81 | Ga0466735_089531 | 3300042624 | Bacteria | 1487 |
| 82 | Ga0466735_212575 | 3300042624 | Unclassified | 2112 |
| 83 | Ga0466704_041876 | 3300042643 | Bacteria | 11886 |
| 84 | Ga0466705_196917 | 3300042612 | Bacteria | 1736 |
| 85 | Ga0265387_1002922 | 3300024582 | Bacteria | 2390 |
| 86 | Ga0466696_063973 | 3300042596 | Bacteria | 3611 |
| 87 | Ga0466706_214048 | 3300042599 | Bacteria | 8098 |
| 88 | Ga0466716_210831 | 3300042605 | Bacteria | 1203 |
| 89 | Ga0466716_468052 | 3300042605 | Bacteria | 3232 |
| 90 | Ga0466719_435046 | 3300042606 | Bacteria | 1633 |
| 91 | Ga0466722_147900 | 3300042609 | Bacteria | 1078 |
| 92 | JGI24702J35022_10001430 | 3300002462 | Bacteria | 14912 |
| 93 | JGI24702J35022_10016326 | 3300002462 | Bacteria | 4070 |
| 94 | Ga0123353_10049930 | 3300010167 | Bacteria | 6666 |
| 95 | Ga0466711_204147 | 3300042615 | Bacteria | 19807 |
| 96 | Ga0466723_084500 | 3300042618 | Bacteria | 15044 |
| 97 | Ga0466726_383712 | 3300042619 | Bacteria | 1670 |
| 98 | Ga0466728_340392 | 3300042620 | Bacteria | 2209 |
| 99 | Ga0466731_314183 | 3300042622 | Bacteria | 2882 |
| 100 | Ga0466703_099551 | 3300042636 | Bacteria | 12782 |
| 101 | Ga0466703_225945 | 3300042636 | Bacteria | 6170 |
| 102 | Ga0466704_081588 | 3300042643 | Bacteria | 15326 |
| 103 | Ga0466708_084130 | 3300042652 | Bacteria | 3322 |
| 104 | Ga0466733_119589 | 3300042659 | Unclassified | 1559 |
| 105 | Ga0466656_189336 | 3300042550 | Unclassified | 1830 |
| 106 | Ga0466656_228043 | 3300042550 | Bacteria | 1736 |
| 107 | Ga0466657_185874 | 3300042582 | Bacteria | 3245 |
| 108 | Ga0466692_099731 | 3300042591 | Bacteria | 2112 |
| 109 | Ga0466696_132155 | 3300042596 | Bacteria | 2737 |
| 110 | Ga0466701_102474 | 3300042598 | Bacteria | 27466 |
| 111 | Ga0466700_151968 | 3300042600 | Unclassified | 2902 |
| 112 | Ga0466721_158763 | 3300042608 | Bacteria | 1249 |
| 113 | JGI24702J35022_10021559 | 3300002462 | Bacteria | 3492 |
| 114 | JGI24699J35502_11050801 | 3300002509 | Bacteria | 1650 |
| 115 | JGI24696J40584_12954072 | 3300002834 | Unclassified | 2580 |
| 116 | Ga0123356_10052167 | 3300010049 | Bacteria | 3804 |
| 117 | Ga0123356_10259128 | 3300010049 | Bacteria | 1822 |
| 118 | Ga0123356_11216479 | 3300010049 | Unclassified | 919 |
| 119 | Ga0123353_10436749 | 3300010167 | Bacteria | 1933 |
| 120 | Ga0466711_036410 | 3300042615 | Bacteria | 2764 |
| 121 | Ga0466711_051286 | 3300042615 | Bacteria | 5850 |
| 122 | Ga0466715_262889 | 3300042616 | Bacteria | 4045 |
| 123 | Ga0466703_209860 | 3300042636 | Bacteria | 1772 |
| 124 | Ga0466703_274880 | 3300042636 | Bacteria | 36873 |
| 125 | Ga0466703_433165 | 3300042636 | Bacteria | 1405 |
| 126 | Ga0466704_411746 | 3300042643 | Bacteria | 2236 |
| 127 | Ga0466709_220634 | 3300042648 | Unclassified | 10846 |
| 128 | Ga0466724_09227 | 3300042649 | Bacteria | 2758 |
| 129 | Ga0466727_268939 | 3300042655 | Bacteria | 4372 |
| 130 | Ga0466705_020893 | 3300042612 | Bacteria | 5244 |
| 131 | Ga0466733_013248 | 3300042659 | Bacteria | 4966 |
| 132 | Ga0466733_179460 | 3300042659 | Bacteria | 7578 |
| 133 | Ga0466690_414684 | 3300042590 | Bacteria | 11361 |
| 134 | Ga0466693_193697 | 3300042592 | Bacteria | 3748 |
| 135 | Ga0466691_077867 | 3300042593 | Bacteria | 12376 |
| 136 | Ga0466706_085763 | 3300042599 | Bacteria | 2345 |
| 137 | Ga0466707_223432 | 3300042601 | Bacteria | 5997 |
| 138 | Ga0466716_162121 | 3300042605 | Bacteria | 9060 |
| 139 | Ga0072941_1069018 | 3300005201 | Bacteria | 1362 |
| 140 | Ga0123357_10019640 | 3300009784 | Bacteria | 9011 |
| 141 | Ga0123357_10306035 | 3300009784 | Bacteria | 1596 |
| 142 | Ga0466715_507886 | 3300042616 | Bacteria | 10225 |
| 143 | Ga0466723_044181 | 3300042618 | Bacteria | 301962 |
| 144 | Ga0466729_141880 | 3300042621 | Bacteria | 2792 |
| 145 | Ga0466735_021146 | 3300042624 | Bacteria | 2061 |
| 146 | Ga0466735_021974 | 3300042624 | Bacteria | 2849 |
| 147 | Ga0466735_030263 | 3300042624 | Unclassified | 2016 |
| 148 | Ga0466735_048758 | 3300042624 | Bacteria | 1296 |
| 149 | Ga0466703_026600 | 3300042636 | Bacteria | 12360 |
| 150 | Ga0466725_204235 | 3300042654 | Unclassified | 1082 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF08843 | AbiEii | Nucleotidyl transferase AbiEii toxin, Type IV TA system | 30 | 228 | 0.85 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.