Protein Family IF05694
Metagenome
Isolate
117
Members
59
Samples
100
Scaffolds
156.84
Avg Length
Representative Sequence
- ID
- 3300042599|Ga0466706_257418|Ga0466706_257418_3773_4312
- Length
- 179 aa
- Sequence
- LKPETPTPSGFSVLNSDRGEENMGKDSIKRVADNRAARHEYFVLESMEAGIELFGTEVKSIRGGGVNLKDAWIGIDGGEAFVNNMHVSPYEKGNIFNRDPLRRRKLLLHKREILKLFGQVRQGGLTLVPLSMYFKGDHVKLQVGLCKGKKLHDKREAIAERDMARMLDRAMKERGRAGD
Sample Types
Isolate
14.5%
Metagenome
85.5%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
25.4%
Unclassified
23.7%
Kalotermitidae
20.3%
Armadillidiidae
6.8%
Culicidae
6.8%
Elmidae
5.1%
Passalidae
3.4%
Daphniidae
1.7%
Hodotermitidae
1.7%
Rhinotermitidae
1.7%
Termopsidae
1.7%
Curculionidae
1.7%
Taxonomy
Archaea
1
Bacteria
108
Eukaryota
0
Viruses
0
Unclassified
8
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2556921669 | Shinella sp. DD12 | Isolate | Daphniidae |
| 2 | 2820333861 | Unclassified Firmicutes Nt197P3bin72 | Isolate | Unclassified |
| 3 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 4 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 5 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 6 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 7 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 8 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 9 | 2820263778 | Unclassified Firmicutes Th196P3bin37 | Isolate | Unclassified |
| 10 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 11 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 12 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 13 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 14 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 15 | 2820255904 | Unclassified Firmicutes Th196P3bin48 | Isolate | Unclassified |
| 16 | 2820360414 | Unclassified Firmicutes Nt197P3bin121 | Isolate | Unclassified |
| 17 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 18 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 19 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 20 | 2864866972 | Brevundimonas bullata S00123 | Isolate | Elmidae |
| 21 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 22 | 2820257794 | Unclassified Firmicutes Th196P3bin47 | Isolate | Unclassified |
| 23 | 2820401926 | Unclassified Firmicutes Mp193P1bin2 | Isolate | Unclassified |
| 24 | 2820528380 | Unclassified Firmicutes Lab288P1bin143 | Isolate | Unclassified |
| 25 | 3300012812 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E11 MG | Metagenome | Culicidae |
| 26 | 3300012819 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E11 MG | Metagenome | Armadillidiidae |
| 27 | 2820288918 | Unclassified Firmicutes Th196P3bin137 | Isolate | Unclassified |
| 28 | 2820387566 | Unclassified Firmicutes Nt197P1bin1 | Isolate | Unclassified |
| 29 | 2820510699 | Unclassified Firmicutes Lab288P1bin40 | Isolate | Unclassified |
| 30 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 31 | 3300002508 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 | Metagenome | Termitidae |
| 32 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 33 | 3300012831 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E6 MG | Metagenome | Culicidae |
| 34 | 3300012849 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG | Metagenome | Culicidae |
| 35 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 36 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 37 | 2864934081 | Brevundimonas vesicularis S00192 | Isolate | Elmidae |
| 38 | 2820309449 | Unclassified Firmicutes Th196P1bin10 | Isolate | Unclassified |
| 39 | 2820565217 | Unclassified Firmicutes Emb289P3bin51 | Isolate | Unclassified |
| 40 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 41 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 42 | 3300012820 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E6 MG | Metagenome | Armadillidiidae |
| 43 | 3300012845 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG | Metagenome | Culicidae |
| 44 | 2864951976 | Brevundimonas bullata S00223 | Isolate | Elmidae |
| 45 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 46 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 47 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 48 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 49 | 3300002507 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 | Metagenome | Termitidae |
| 50 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 51 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 52 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 53 | 2820637417 | Unclassified Firmicutes Emb289P1bin108 | Isolate | Unclassified |
| 54 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 55 | 3300003973 | Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle | Metagenome | Curculionidae |
| 56 | 3300012847 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG | Metagenome | Armadillidiidae |
| 57 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 58 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 59 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | JGI24705J35276_11883663 | 3300002504 | Bacteria | 738 |
| 2 | JGI24697J35500_11274936 | 3300002507 | Bacteria | 15367 |
| 3 | Ga0466691_084732 | 3300042593 | Bacteria | 37201 |
| 4 | Ga0466696_167606 | 3300042596 | Bacteria | 1245 |
| 5 | Ga0123355_10433039 | 3300009826 | Bacteria | 1671 |
| 6 | Ga0123355_11159984 | 3300009826 | Bacteria | 795 |
| 7 | Ga0123356_10466732 | 3300010049 | Bacteria | 1413 |
| 8 | Ga0123356_10587178 | 3300010049 | Bacteria | 1278 |
| 9 | Ga0123353_10047927 | 3300010167 | Bacteria | 6801 |
| 10 | Ga0123353_10321983 | 3300010167 | Bacteria | 2346 |
| 11 | Ga0123353_11063959 | 3300010167 | Bacteria | 1079 |
| 12 | Ga0466713_044657 | 3300042602 | Bacteria | 2725 |
| 13 | Ga0466708_395057 | 3300042652 | Bacteria | 18593 |
| 14 | Ga0123353_10980172 | 3300010167 | Bacteria | 1139 |
| 15 | Ga0466706_002469 | 3300042599 | Bacteria | 56083 |
| 16 | Ga0466706_049436 | 3300042599 | Bacteria | 21133 |
| 17 | Ga0466721_052714 | 3300042608 | Bacteria | 1205 |
| 18 | Ga0466711_081848 | 3300042615 | Bacteria | 31590 |
| 19 | Ga0466702_141835 | 3300042635 | Bacteria | 1050 |
| 20 | JGI24705J35276_12230670 | 3300002504 | Bacteria | 3694 |
| 21 | Ga0063521_1005675 | 3300003973 | Bacteria | 2949 |
| 22 | Ga0415639_104033 | 3300038395 | Bacteria | 7371 |
| 23 | Ga0123355_10105469 | 3300009826 | Bacteria | 4422 |
| 24 | Ga0123356_10197526 | 3300010049 | Bacteria | 2049 |
| 25 | Ga0123356_10449819 | 3300010049 | Bacteria | 1436 |
| 26 | Ga0123353_10000367 | 3300010167 | Bacteria | 55223 |
| 27 | Ga0466706_028319 | 3300042599 | Unclassified | 2444 |
| 28 | Ga0466706_112904 | 3300042599 | Unclassified | 17415 |
| 29 | Ga0466706_191266 | 3300042599 | Bacteria | 1558 |
| 30 | Ga0466722_094041 | 3300042609 | Bacteria | 6098 |
| 31 | Ga0466715_256949 | 3300042616 | Bacteria | 6944 |
| 32 | Ga0466728_043720 | 3300042620 | Bacteria | 1998 |
| 33 | Ga0466702_023081 | 3300042635 | Bacteria | 1683 |
| 34 | Ga0466702_238390 | 3300042635 | Bacteria | 47102 |
| 35 | Ga0466703_061734 | 3300042636 | Bacteria | 10432 |
| 36 | AustNasuHG_c1000468 | 3300000089 | Bacteria | 14178 |
| 37 | Ga0415639_015756 | 3300038395 | Bacteria | 15755 |
| 38 | Ga0415639_016475 | 3300038395 | Bacteria | 4658 |
| 39 | Ga0123356_10598970 | 3300010049 | Bacteria | 1267 |
| 40 | Ga0466706_143831 | 3300042599 | Unclassified | 13903 |
| 41 | Ga0466706_235257 | 3300042599 | Unclassified | 10096 |
| 42 | Ga0466714_067068 | 3300042603 | Bacteria | 1245 |
| 43 | Ga0466715_053603 | 3300042616 | Bacteria | 17034 |
| 44 | Ga0466702_083067 | 3300042635 | Bacteria | 3978 |
| 45 | Ga0466705_234039 | 3300042612 | Bacteria | 8431 |
| 46 | IMNBL1DRAFT_c0004097 | 3300000062 | Bacteria | 8908 |
| 47 | JGI24700J35501_10930418 | 3300002508 | Unclassified | 13814 |
| 48 | Ga0123355_10409538 | 3300009826 | Bacteria | 1742 |
| 49 | Ga0466706_136045 | 3300042599 | Bacteria | 12966 |
| 50 | Ga0466711_252912 | 3300042615 | Bacteria | 2631 |
| 51 | Ga0466723_185692 | 3300042618 | Bacteria | 13967 |
| 52 | Ga0466735_183619 | 3300042624 | Bacteria | 1086 |
| 53 | Ga0466703_023745 | 3300042636 | Bacteria | 2398 |
| 54 | Ga0466709_288986 | 3300042648 | Bacteria | 6924 |
| 55 | 2227506286 | 2225789004 | Bacteria | 718 |
| 56 | JGI24705J35276_11474297 | 3300002504 | Unclassified | 549 |
| 57 | Ga0160460_100132 | 3300012845 | Bacteria | 88291 |
| 58 | Ga0160445_109654 | 3300012847 | Bacteria | 1445 |
| 59 | Ga0415639_027796 | 3300038395 | Bacteria | 7467 |
| 60 | Ga0415639_097230 | 3300038395 | Bacteria | 5497 |
| 61 | Ga0466690_037815 | 3300042590 | Bacteria | 2194 |
| 62 | Ga0466696_327423 | 3300042596 | Bacteria | 4873 |
| 63 | Ga0123355_10007316 | 3300009826 | Bacteria | 16526 |
| 64 | Ga0123353_12003476 | 3300010167 | Bacteria | 709 |
| 65 | Ga0160471_112157 | 3300012812 | Bacteria | 905 |
| 66 | Ga0466706_058480 | 3300042599 | Bacteria | 3126 |
| 67 | Ga0466706_210728 | 3300042599 | Bacteria | 56896 |
| 68 | Ga0466722_251133 | 3300042609 | Bacteria | 83612 |
| 69 | Ga0466731_407501 | 3300042622 | Bacteria | 41857 |
| 70 | Ga0466703_127396 | 3300042636 | Bacteria | 1849 |
| 71 | Ga0466708_067276 | 3300042652 | Bacteria | 5655 |
| 72 | Ga0466708_073499 | 3300042652 | Bacteria | 29570 |
| 73 | Ga0466708_165589 | 3300042652 | Bacteria | 1595 |
| 74 | Ga0415639_100000 | 3300038395 | Bacteria | 6278 |
| 75 | Ga0466691_159866 | 3300042593 | Bacteria | 3290 |
| 76 | Ga0123355_10005300 | 3300009826 | Bacteria | 18837 |
| 77 | Ga0123355_10235521 | 3300009826 | Bacteria | 2605 |
| 78 | Ga0123356_10064564 | 3300010049 | Bacteria | 3423 |
| 79 | Ga0123356_11322927 | 3300010049 | Bacteria | 883 |
| 80 | Ga0466706_000590 | 3300042599 | Bacteria | 4481 |
| 81 | Ga0466706_110991 | 3300042599 | Bacteria | 5427 |
| 82 | Ga0466716_347892 | 3300042605 | Bacteria | 2518 |
| 83 | Ga0466721_231901 | 3300042608 | Bacteria | 5077 |
| 84 | Ga0466723_252436 | 3300042618 | Bacteria | 4868 |
| 85 | Ga0466732_419510 | 3300042656 | Bacteria | 2260 |
| 86 | JGI24705J35276_12238126 | 3300002504 | Bacteria | 16235 |
| 87 | Ga0072940_1037192 | 3300005200 | Bacteria | 9839 |
| 88 | Ga0160468_100004 | 3300012819 | Bacteria | 631412 |
| 89 | Ga0160456_107085 | 3300012820 | Unclassified | 1265 |
| 90 | Ga0160459_108454 | 3300012831 | Bacteria | 1267 |
| 91 | Ga0160433_100004 | 3300012846 | Bacteria | 543746 |
| 92 | Ga0160447_100005 | 3300012849 | Bacteria | 543831 |
| 93 | Ga0123355_11215101 | 3300009826 | Bacteria | 767 |
| 94 | Ga0123353_12538391 | 3300010167 | Bacteria | 608 |
| 95 | Ga0466706_014433 | 3300042599 | Unclassified | 3201 |
| 96 | Ga0466706_056077 | 3300042599 | Bacteria | 1696 |
| 97 | Ga0466706_257418 | 3300042599 | Bacteria | 6161 |
| 98 | Ga0466714_036177 | 3300042603 | Bacteria | 3712 |
| 99 | Ga0466717_052624 | 3300042604 | Archaea | 1138 |
| 100 | Ga0466716_263071 | 3300042605 | Bacteria | 1230 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01668 | SmpB | SmpB protein | 31 | 173 | 0.99 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF01668 | GO:0003723 | RNA binding | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.