Protein Family IF05667
Metagenome
Isolate
277
Members
78
Samples
256
Scaffolds
355.9
Avg Length
Representative Sequence
- ID
- 3300042599|Ga0466706_208756|Ga0466706_208756_513_1610
- Length
- 365 aa
- Sequence
- MNKNSSIFVAGHKGLVGSAIDKLLQEKGYTNIIRRNFEALNLSNQEKTKDFFEKTRPEYVFLAAAHVGGIVANNIYRADFIYNNLQIQNNVIYNSYKYGVKKLLFLGSTCIYPAQCPQPMKEEYLLTDTLEYTNEPYAIAKIAGLKMCESFNLQYGTNFIAVMPTNLYGPNDNFNLEKSHVLPALIRKAHLGKALMEGDWEMIRKDLKKYPIEKVDQNSSEKDIEDILEKYGVKKENGKVSIEIWGSGTPLREFLWSEEMADACIFVMENVDFEDLKPKNTDQIRNCHINIGTGKEITIKDLAYLIAKTIDFSGDIVFNSNKPDGTMRKLTDPSRLNSLGWHHKIEIDEGIKKLYSWYKTSLFSI
Sample Types
Isolate
7.6%
Metagenome
92.4%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
32.9%
Blattidae
19.7%
Kalotermitidae
18.4%
Unclassified
11.8%
Rhinotermitidae
3.9%
Termopsidae
3.9%
Passalidae
2.6%
Formicidae
2.6%
Hodotermitidae
1.3%
Armadillidiidae
1.3%
Culicidae
1.3%
Taxonomy
Archaea
0
Bacteria
276
Eukaryota
0
Viruses
0
Unclassified
1
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2940199050 | Parabacteroides sp. PM6-13 | Isolate | Blattidae |
| 2 | 2940371297 | Parabacteroides sp. PM5-20 | Isolate | Blattidae |
| 3 | 2967483437 | Candidatus Ordinivivax streblomastigis St1 | Isolate | Unclassified |
| 4 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 5 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 6 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 7 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 8 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 9 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 10 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 11 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 12 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 13 | 2820759988 | Unclassified Bacteroidetes Mp193P4bin4 | Isolate | Unclassified |
| 14 | 2820770630 | Unclassified Bacteroidetes Lab288P3bin130 | Isolate | Unclassified |
| 15 | 2923982719 | Parabacteroides sp. 52 | Isolate | Blattidae |
| 16 | 2940328985 | Parabacteroides sp. PH5-46 | Isolate | Blattidae |
| 17 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 18 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 19 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 20 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 21 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 22 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 23 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 24 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 25 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 26 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 27 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 28 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 29 | 2820778767 | Unclassified Bacteroidetes Emb289P4bin10 | Isolate | Unclassified |
| 30 | 2940212447 | Parabacteroides sp. PH5-16 | Isolate | Blattidae |
| 31 | 2940302308 | Parabacteroides sp. PF5-5 | Isolate | Blattidae |
| 32 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 33 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 34 | 3300007095 | Ant gut microbial communities from Cephalotes minutus, Brazil | Metagenome | Formicidae |
| 35 | 3300012841 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E1 MG | Metagenome | Armadillidiidae |
| 36 | 3300012852 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG | Metagenome | |
| 37 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 38 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 39 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 40 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 41 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 42 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 43 | 2922326829 | Bacteroides sp. 224 | Isolate | Blattidae |
| 44 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 45 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 46 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 47 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 48 | 2820762746 | Unclassified Bacteroidetes Mp193P4bin3 | Isolate | Unclassified |
| 49 | 2940205530 | Parabacteroides sp. PH5-33 | Isolate | Blattidae |
| 50 | 2940216256 | Dysgonomonadaceae bacterium PH5-43 | Isolate | Blattidae |
| 51 | 2940325180 | Parabacteroides sp. PH5-41 | Isolate | Blattidae |
| 52 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 53 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 54 | 2820785563 | Unclassified Bacteroidetes Emb289P1bin74 | Isolate | Unclassified |
| 55 | 2940346213 | Parabacteroides sp. PFB2-12 | Isolate | Blattidae |
| 56 | 3004677695 | Bacteroides sp. 214 | Isolate | Blattidae |
| 57 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 58 | 3300007139 | Ant gut microbial communities from Cephalotes pellans, Brazil | Metagenome | Formicidae |
| 59 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 60 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 61 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 62 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 63 | 3300012857 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG | Metagenome | Culicidae |
| 64 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 65 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 66 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 67 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 68 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 69 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 70 | 2940195863 | Parabacteroides sp. PF5-6 | Isolate | Blattidae |
| 71 | 2940298504 | Parabacteroides sp. PF5-13 | Isolate | Blattidae |
| 72 | 3004667792 | Bacteroides sp. 519 | Isolate | Blattidae |
| 73 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 74 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 75 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 76 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 77 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 78 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466706_271412 | 3300042599 | Bacteria | 9637 |
| 2 | Ga0466716_195372 | 3300042605 | Bacteria | 22749 |
| 3 | Ga0466716_482874 | 3300042605 | Bacteria | 1246 |
| 4 | Ga0466719_548832 | 3300042606 | Bacteria | 1484 |
| 5 | Ga0466715_201569 | 3300042616 | Bacteria | 7426 |
| 6 | Ga0466723_365550 | 3300042618 | Bacteria | 29929 |
| 7 | Ga0466726_047946 | 3300042619 | Bacteria | 8061 |
| 8 | Ga0466728_035041 | 3300042620 | Bacteria | 1217 |
| 9 | Ga0466729_013297 | 3300042621 | Bacteria | 10400 |
| 10 | JGI24702J35022_10001926 | 3300002462 | Bacteria | 12794 |
| 11 | Ga0068305_10064185 | 3300005083 | Bacteria | 5436 |
| 12 | Ga0102739_1000033 | 3300007095 | Bacteria | 57715 |
| 13 | Ga0103260_1000204 | 3300007139 | Bacteria | 12885 |
| 14 | Ga0123353_10000282 | 3300010167 | Bacteria | 62813 |
| 15 | Ga0123354_10000449 | 3300010882 | Bacteria | 40514 |
| 16 | Ga0466734_164245 | 3300042623 | Bacteria | 1765 |
| 17 | Ga0466703_122469 | 3300042636 | Bacteria | 7551 |
| 18 | Ga0466704_153598 | 3300042643 | Bacteria | 8033 |
| 19 | Ga0466704_212859 | 3300042643 | Bacteria | 6912 |
| 20 | Ga0466704_375643 | 3300042643 | Bacteria | 5311 |
| 21 | Ga0466709_336945 | 3300042648 | Bacteria | 30367 |
| 22 | Ga0466727_078492 | 3300042655 | Bacteria | 66886 |
| 23 | Ga0466690_077766 | 3300042590 | Bacteria | 7365 |
| 24 | Ga0466692_005503 | 3300042591 | Bacteria | 4214 |
| 25 | Ga0466694_273526 | 3300042594 | Bacteria | 1965 |
| 26 | Ga0466696_205584 | 3300042596 | Bacteria | 3076 |
| 27 | Ga0466696_208262 | 3300042596 | Bacteria | 11018 |
| 28 | Ga0466733_061035 | 3300042659 | Bacteria | 4445 |
| 29 | Ga0466733_066766 | 3300042659 | Bacteria | 5447 |
| 30 | Ga0466706_099595 | 3300042599 | Bacteria | 6890 |
| 31 | Ga0466707_018608 | 3300042601 | Bacteria | 1317 |
| 32 | Ga0466707_091732 | 3300042601 | Bacteria | 9253 |
| 33 | Ga0466707_213150 | 3300042601 | Bacteria | 55646 |
| 34 | Ga0466719_024374 | 3300042606 | Bacteria | 5042 |
| 35 | Ga0466719_273064 | 3300042606 | Bacteria | 1838 |
| 36 | Ga0466722_039440 | 3300042609 | Bacteria | 12390 |
| 37 | Ga0466722_252821 | 3300042609 | Bacteria | 235840 |
| 38 | Ga0466705_402901 | 3300042612 | Bacteria | 3321 |
| 39 | Ga0466711_209833 | 3300042615 | Bacteria | 6167 |
| 40 | Ga0466711_222547 | 3300042615 | Bacteria | 19633 |
| 41 | Ga0466715_205452 | 3300042616 | Bacteria | 6836 |
| 42 | Ga0466726_437862 | 3300042619 | Bacteria | 13308 |
| 43 | Ga0466728_126150 | 3300042620 | Bacteria | 3532 |
| 44 | 2227480194 | 2225789004 | Bacteria | 22279 |
| 45 | IMNBL1DRAFT_c0001178 | 3300000062 | Bacteria | 19919 |
| 46 | JGI24705J35276_12236814 | 3300002504 | Bacteria | 8983 |
| 47 | Ga0123357_10039079 | 3300009784 | Bacteria | 6462 |
| 48 | Ga0123355_10000973 | 3300009826 | Bacteria | 39666 |
| 49 | Ga0123356_10091235 | 3300010049 | Bacteria | 2903 |
| 50 | Ga0123354_10008097 | 3300010882 | Bacteria | 15950 |
| 51 | Ga0123354_10015036 | 3300010882 | Bacteria | 12069 |
| 52 | Ga0466731_116898 | 3300042622 | Bacteria | 13314 |
| 53 | Ga0466735_042327 | 3300042624 | Bacteria | 6599 |
| 54 | Ga0466735_063626 | 3300042624 | Bacteria | 3281 |
| 55 | Ga0466735_073455 | 3300042624 | Bacteria | 2552 |
| 56 | Ga0466703_116725 | 3300042636 | Bacteria | 5085 |
| 57 | Ga0466704_087411 | 3300042643 | Bacteria | 64481 |
| 58 | Ga0466704_471553 | 3300042643 | Bacteria | 27076 |
| 59 | Ga0466709_057282 | 3300042648 | Bacteria | 8232 |
| 60 | Ga0466708_459292 | 3300042652 | Bacteria | 18825 |
| 61 | Ga0466694_232705 | 3300042594 | Bacteria | 2837 |
| 62 | Ga0466696_240220 | 3300042596 | Bacteria | 3777 |
| 63 | Ga0466705_115034 | 3300042612 | Bacteria | 9257 |
| 64 | Ga0466701_094524 | 3300042598 | Bacteria | 18120 |
| 65 | Ga0466706_208756 | 3300042599 | Bacteria | 25960 |
| 66 | Ga0466700_201402 | 3300042600 | Bacteria | 4270 |
| 67 | Ga0466707_185312 | 3300042601 | Bacteria | 99373 |
| 68 | Ga0466707_189059 | 3300042601 | Bacteria | 7875 |
| 69 | Ga0466713_007766 | 3300042602 | Bacteria | 67445 |
| 70 | Ga0466719_154368 | 3300042606 | Bacteria | 5831 |
| 71 | Ga0466719_298833 | 3300042606 | Bacteria | 12667 |
| 72 | Ga0466719_414605 | 3300042606 | Bacteria | 1392 |
| 73 | Ga0466722_005736 | 3300042609 | Bacteria | 14602 |
| 74 | Ga0466711_196937 | 3300042615 | Bacteria | 36467 |
| 75 | Ga0466711_349967 | 3300042615 | Bacteria | 5515 |
| 76 | Ga0466711_408129 | 3300042615 | Bacteria | 10541 |
| 77 | Ga0466715_472449 | 3300042616 | Bacteria | 8612 |
| 78 | Ga0466723_023862 | 3300042618 | Bacteria | 63714 |
| 79 | Ga0466723_360512 | 3300042618 | Bacteria | 4742 |
| 80 | Ga0466728_252508 | 3300042620 | Bacteria | 98207 |
| 81 | Ga0466728_260357 | 3300042620 | Bacteria | 6543 |
| 82 | 2227671830 | 2225789004 | Bacteria | 10160 |
| 83 | JGI24702J35022_10159659 | 3300002462 | Bacteria | 1269 |
| 84 | JGI24699J35502_11131381 | 3300002509 | Bacteria | 5663 |
| 85 | JGI24699J35502_11134217 | 3300002509 | Bacteria | 65443 |
| 86 | Ga0068305_10031013 | 3300005083 | Bacteria | 15729 |
| 87 | Ga0123356_10157630 | 3300010049 | Bacteria | 2263 |
| 88 | Ga0123353_10084898 | 3300010167 | Bacteria | 5097 |
| 89 | Ga0123353_10839568 | 3300010167 | Bacteria | 1261 |
| 90 | Ga0123354_10001155 | 3300010882 | Bacteria | 30901 |
| 91 | Ga0123354_10051416 | 3300010882 | Bacteria | 6223 |
| 92 | Ga0466735_057991 | 3300042624 | Bacteria | 3506 |
| 93 | Ga0466703_134434 | 3300042636 | Bacteria | 7478 |
| 94 | Ga0466703_195402 | 3300042636 | Bacteria | 6824 |
| 95 | Ga0466704_263798 | 3300042643 | Bacteria | 2861 |
| 96 | Ga0466727_245904 | 3300042655 | Bacteria | 6871 |
| 97 | Ga0466657_326060 | 3300042582 | Bacteria | 13466 |
| 98 | Ga0466690_276223 | 3300042590 | Bacteria | 213056 |
| 99 | Ga0466691_043152 | 3300042593 | Bacteria | 12747 |
| 100 | Ga0466699_026047 | 3300042597 | Bacteria | 1835 |
| 101 | Ga0466701_007712 | 3300042598 | Bacteria | 3410 |
| 102 | Ga0466705_281432 | 3300042612 | Bacteria | 24457 |
| 103 | Ga0466732_401609 | 3300042656 | Bacteria | 4703 |
| 104 | Ga0466733_082206 | 3300042659 | Bacteria | 21155 |
| 105 | Ga0466706_248951 | 3300042599 | Bacteria | 16037 |
| 106 | Ga0466707_012299 | 3300042601 | Bacteria | 3446 |
| 107 | Ga0466707_110727 | 3300042601 | Bacteria | 35379 |
| 108 | Ga0466716_434354 | 3300042605 | Bacteria | 10667 |
| 109 | Ga0466719_508576 | 3300042606 | Bacteria | 7021 |
| 110 | Ga0466715_056569 | 3300042616 | Bacteria | 35867 |
| 111 | Ga0466728_202383 | 3300042620 | Bacteria | 8484 |
| 112 | Ga0466728_421585 | 3300042620 | Bacteria | 85151 |
| 113 | 2227482969 | 2225789004 | Bacteria | 21843 |
| 114 | IMNBL1DRAFT_c0009132 | 3300000062 | Bacteria | 4946 |
| 115 | JGI24702J35022_10000891 | 3300002462 | Bacteria | 18536 |
| 116 | JGI24702J35022_10002083 | 3300002462 | Bacteria | 12345 |
| 117 | Ga0072941_1194917 | 3300005201 | Bacteria | 3270 |
| 118 | Ga0123353_10096308 | 3300010167 | Bacteria | 4769 |
| 119 | Ga0466735_154703 | 3300042624 | Bacteria | 3148 |
| 120 | Ga0466703_148075 | 3300042636 | Bacteria | 9387 |
| 121 | Ga0466704_118560 | 3300042643 | Bacteria | 17591 |
| 122 | Ga0466704_145813 | 3300042643 | Bacteria | 16639 |
| 123 | Ga0466708_117026 | 3300042652 | Bacteria | 7497 |
| 124 | Ga0466725_143481 | 3300042654 | Bacteria | 4928 |
| 125 | Ga0466727_026570 | 3300042655 | Bacteria | 2992 |
| 126 | Ga0466727_033362 | 3300042655 | Bacteria | 8155 |
| 127 | Ga0466691_226541 | 3300042593 | Bacteria | 1483 |
| 128 | Ga0466699_394361 | 3300042597 | Bacteria | 1501 |
| 129 | Ga0466733_096868 | 3300042659 | Bacteria | 74750 |
| 130 | Ga0466706_277766 | 3300042599 | Bacteria | 14338 |
| 131 | Ga0466713_017186 | 3300042602 | Bacteria | 16604 |
| 132 | Ga0466719_009442 | 3300042606 | Bacteria | 5079 |
| 133 | Ga0466719_211343 | 3300042606 | Bacteria | 5808 |
| 134 | Ga0466721_227296 | 3300042608 | Bacteria | 3248 |
| 135 | Ga0466711_126741 | 3300042615 | Bacteria | 16744 |
| 136 | Ga0466711_173669 | 3300042615 | Bacteria | 8588 |
| 137 | Ga0466711_263836 | 3300042615 | Bacteria | 5514 |
| 138 | Ga0466715_189742 | 3300042616 | Bacteria | 14195 |
| 139 | Ga0466715_199813 | 3300042616 | Bacteria | 9480 |
| 140 | Ga0466715_434942 | 3300042616 | Bacteria | 16490 |
| 141 | Ga0466723_045945 | 3300042618 | Bacteria | 2472 |
| 142 | Ga0466728_378724 | 3300042620 | Bacteria | 10575 |
| 143 | 2227632961 | 2225789004 | Bacteria | 11276 |
| 144 | IMNBL1DRAFT_c0000063 | 3300000062 | Bacteria | 97352 |
| 145 | JGI24702J35022_10012481 | 3300002462 | Bacteria | 4721 |
| 146 | JGI24702J35022_10099240 | 3300002462 | Bacteria | 1592 |
| 147 | Ga0123357_10015494 | 3300009784 | Bacteria | 9998 |
| 148 | Ga0123357_10021739 | 3300009784 | Bacteria | 8589 |
| 149 | Ga0123357_10032103 | 3300009784 | Bacteria | 7127 |
| 150 | Ga0123354_10000120 | 3300010882 | Bacteria | 58957 |
| 151 | Ga0466735_039161 | 3300042624 | Bacteria | 4265 |
| 152 | Ga0466735_108078 | 3300042624 | Bacteria | 6772 |
| 153 | Ga0466735_198999 | 3300042624 | Bacteria | 2565 |
| 154 | Ga0466703_229363 | 3300042636 | Bacteria | 12678 |
| 155 | Ga0466704_032817 | 3300042643 | Bacteria | 4538 |
| 156 | Ga0466704_427206 | 3300042643 | Bacteria | 28259 |
| 157 | Ga0466709_091252 | 3300042648 | Bacteria | 33511 |
| 158 | Ga0466725_343485 | 3300042654 | Bacteria | 15574 |
| 159 | Ga0160444_100084 | 3300012841 | Bacteria | 124101 |
| 160 | Ga0466656_032753 | 3300042550 | Bacteria | 2841 |
| 161 | Ga0466691_007085 | 3300042593 | Bacteria | 17879 |
| 162 | Ga0466691_020313 | 3300042593 | Bacteria | 5946 |
| 163 | Ga0466691_126463 | 3300042593 | Bacteria | 52297 |
| 164 | Ga0466696_344787 | 3300042596 | Bacteria | 4717 |
| 165 | Ga0466701_001313 | 3300042598 | Bacteria | 3460 |
| 166 | Ga0466705_003352 | 3300042612 | Bacteria | 7369 |
| 167 | Ga0466733_107784 | 3300042659 | Bacteria | 11922 |
| 168 | Ga0466733_219939 | 3300042659 | Bacteria | 1524 |
| 169 | Ga0466713_073756 | 3300042602 | Bacteria | 34943 |
| 170 | Ga0466714_122466 | 3300042603 | Bacteria | 168454 |
| 171 | Ga0466716_443331 | 3300042605 | Bacteria | 6006 |
| 172 | Ga0466719_234058 | 3300042606 | Bacteria | 2571 |
| 173 | Ga0466722_243033 | 3300042609 | Bacteria | 15699 |
| 174 | Ga0466710_032225 | 3300042613 | Bacteria | 1102 |
| 175 | Ga0466711_342390 | 3300042615 | Bacteria | 5891 |
| 176 | Ga0466715_029864 | 3300042616 | Bacteria | 17387 |
| 177 | Ga0466715_047082 | 3300042616 | Bacteria | 54165 |
| 178 | Ga0466728_442384 | 3300042620 | Bacteria | 6402 |
| 179 | 2227530184 | 2225789004 | Bacteria | 16374 |
| 180 | JGI24699J35502_11134165 | 3300002509 | Bacteria | 42441 |
| 181 | Ga0123357_10000044 | 3300009784 | Bacteria | 100721 |
| 182 | Ga0123357_10000156 | 3300009784 | Bacteria | 60987 |
| 183 | Ga0123357_10188508 | 3300009784 | Bacteria | 2385 |
| 184 | Ga0123356_10023470 | 3300010049 | Bacteria | 5803 |
| 185 | Ga0123356_10059188 | 3300010049 | Bacteria | 3573 |
| 186 | Ga0466734_073691 | 3300042623 | Bacteria | 1694 |
| 187 | Ga0466735_127093 | 3300042624 | Bacteria | 5814 |
| 188 | Ga0466703_050557 | 3300042636 | Bacteria | 2143 |
| 189 | Ga0466703_084551 | 3300042636 | Bacteria | 6110 |
| 190 | Ga0466704_024801 | 3300042643 | Bacteria | 23494 |
| 191 | Ga0466704_410706 | 3300042643 | Bacteria | 1836 |
| 192 | Ga0466709_164144 | 3300042648 | Bacteria | 69976 |
| 193 | Ga0466727_030340 | 3300042655 | Bacteria | 1872 |
| 194 | Ga0466690_031927 | 3300042590 | Bacteria | 7839 |
| 195 | Ga0466690_198679 | 3300042590 | Bacteria | 13637 |
| 196 | Ga0466692_084792 | 3300042591 | Bacteria | 13284 |
| 197 | Ga0466692_089926 | 3300042591 | Bacteria | 6155 |
| 198 | Ga0466692_188071 | 3300042591 | Bacteria | 6102 |
| 199 | Ga0466692_197923 | 3300042591 | Bacteria | 16671 |
| 200 | Ga0466691_106939 | 3300042593 | Bacteria | 15943 |
| 201 | Ga0466696_076900 | 3300042596 | Bacteria | 14965 |
| 202 | Ga0466696_477973 | 3300042596 | Bacteria | 20738 |
| 203 | Ga0466696_500331 | 3300042596 | Bacteria | 32699 |
| 204 | Ga0466705_168860 | 3300042612 | Bacteria | 4550 |
| 205 | Ga0466705_274152 | 3300042612 | Bacteria | 27258 |
| 206 | Ga0466701_021388 | 3300042598 | Bacteria | 3137 |
| 207 | Ga0466716_257211 | 3300042605 | Bacteria | 5130 |
| 208 | Ga0466722_096172 | 3300042609 | Bacteria | 28272 |
| 209 | Ga0466698_416389 | 3300042610 | Bacteria | 1620 |
| 210 | Ga0466711_004876 | 3300042615 | Bacteria | 13509 |
| 211 | Ga0466715_186828 | 3300042616 | Bacteria | 12554 |
| 212 | 2227528790 | 2225789004 | Bacteria | 3194 |
| 213 | 2227609343 | 2225789004 | Bacteria | 2273 |
| 214 | IMNBL1DRAFT_c0003135 | 3300000062 | Bacteria | 10878 |
| 215 | JGI24702J35022_10017591 | 3300002462 | Bacteria | 3905 |
| 216 | JGI24702J35022_10096916 | 3300002462 | Bacteria | 1611 |
| 217 | Ga0123357_10084320 | 3300009784 | Bacteria | 4165 |
| 218 | Ga0466703_058422 | 3300042636 | Bacteria | 13763 |
| 219 | Ga0466704_021831 | 3300042643 | Bacteria | 5781 |
| 220 | Ga0466704_269119 | 3300042643 | Bacteria | 1275 |
| 221 | Ga0466704_314375 | 3300042643 | Bacteria | 15355 |
| 222 | Ga0466704_621580 | 3300042643 | Bacteria | 4963 |
| 223 | Ga0466709_300981 | 3300042648 | Bacteria | 14546 |
| 224 | Ga0160435_1000622 | 3300012857 | Bacteria | 10419 |
| 225 | Ga0466656_121849 | 3300042550 | Bacteria | 2362 |
| 226 | Ga0466690_144909 | 3300042590 | Bacteria | 5804 |
| 227 | Ga0466692_198410 | 3300042591 | Bacteria | 2145 |
| 228 | Ga0466692_201124 | 3300042591 | Bacteria | 11005 |
| 229 | Ga0466691_059007 | 3300042593 | Bacteria | 121940 |
| 230 | Ga0466696_047989 | 3300042596 | Bacteria | 8306 |
| 231 | Ga0466696_267530 | 3300042596 | Bacteria | 14385 |
| 232 | Ga0466696_364335 | 3300042596 | Bacteria | 6381 |
| 233 | Ga0466696_440743 | 3300042596 | Bacteria | 6338 |
| 234 | Ga0466697_143456 | 3300042611 | Bacteria | 2043 |
| 235 | Ga0466700_020224 | 3300042600 | Bacteria | 23800 |
| 236 | Ga0466707_423015 | 3300042601 | Bacteria | 5571 |
| 237 | Ga0466716_507390 | 3300042605 | Bacteria | 50325 |
| 238 | Ga0466722_007711 | 3300042609 | Bacteria | 7334 |
| 239 | Ga0466722_127247 | 3300042609 | Bacteria | 26149 |
| 240 | Ga0466723_186440 | 3300042618 | Bacteria | 54567 |
| 241 | Ga0466726_227706 | 3300042619 | Bacteria | 1146 |
| 242 | Ga0466726_303892 | 3300042619 | Bacteria | 15569 |
| 243 | IMNBL1DRAFT_c0002014 | 3300000062 | Bacteria | 14560 |
| 244 | IMNBL1DRAFT_c0016588 | 3300000062 | Bacteria | 3145 |
| 245 | JGI24702J35022_10017492 | 3300002462 | Bacteria | 3916 |
| 246 | JGI24696J40584_12961017 | 3300002834 | Bacteria | 10017 |
| 247 | Ga0123357_10000568 | 3300009784 | Bacteria | 36446 |
| 248 | Ga0123357_10029081 | 3300009784 | Bacteria | 7490 |
| 249 | Ga0123356_10200921 | 3300010049 | Bacteria | 2033 |
| 250 | Ga0466703_307770 | 3300042636 | Bacteria | 1594 |
| 251 | Ga0466704_127309 | 3300042643 | Bacteria | 4625 |
| 252 | Ga0466708_099450 | 3300042652 | Bacteria | 5425 |
| 253 | Ga0466708_395382 | 3300042652 | Unclassified | 2823 |
| 254 | Ga0160430_113778 | 3300012852 | Bacteria | 1267 |
| 255 | Ga0466690_019550 | 3300042590 | Bacteria | 4642 |
| 256 | Ga0466692_200304 | 3300042591 | Bacteria | 11742 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.